Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 313751..314445 | Replicon | chromosome |
| Accession | NZ_CP123951 | ||
| Organism | Escherichia coli strain TL012 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | QGM68_RS01510 | Protein ID | WP_001263493.1 |
| Coordinates | 313751..314149 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | - |
| Locus tag | QGM68_RS01515 | Protein ID | WP_152927302.1 |
| Coordinates | 314152..314445 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (308809) | 308809..308889 | - | 81 | NuclAT_8 | - | - |
| - (308809) | 308809..308889 | - | 81 | NuclAT_8 | - | - |
| - (308809) | 308809..308889 | - | 81 | NuclAT_8 | - | - |
| - (308809) | 308809..308889 | - | 81 | NuclAT_8 | - | - |
| QGM68_RS01480 (309485) | 309485..309943 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| QGM68_RS01485 (310204) | 310204..311661 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| QGM68_RS01490 (311718) | 311718..312239 | - | 522 | Protein_293 | peptide chain release factor H | - |
| QGM68_RS01495 (312238) | 312238..312441 | - | 204 | Protein_294 | RtcB family protein | - |
| QGM68_RS01505 (313451) | 313451..313741 | - | 291 | Protein_296 | GNAT family N-acetyltransferase | - |
| QGM68_RS01510 (313751) | 313751..314149 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QGM68_RS01515 (314152) | 314152..314445 | - | 294 | WP_152927302.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QGM68_RS01520 (314497) | 314497..315552 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| QGM68_RS01525 (315623) | 315623..316408 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
| QGM68_RS01530 (316380) | 316380..318092 | + | 1713 | Protein_301 | flagellar biosynthesis protein FlhA | - |
| QGM68_RS01535 (318316) | 318316..318813 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 312699..313202 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T279226 WP_001263493.1 NZ_CP123951:c314149-313751 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|