Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1778693..1779284 | Replicon | chromosome |
Accession | NZ_CP123909 | ||
Organism | Pseudomonas atacamensis strain MGMM4 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QG303_RS08285 | Protein ID | WP_281121056.1 |
Coordinates | 1779006..1779284 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | A0A4Q4L7P5 |
Locus tag | QG303_RS08280 | Protein ID | WP_039757791.1 |
Coordinates | 1778693..1778998 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG303_RS08250 (QG303_08250) | 1774218..1774925 | + | 708 | WP_281121055.1 | HAD family hydrolase | - |
QG303_RS08255 (QG303_08255) | 1775143..1775469 | - | 327 | WP_016772583.1 | transcriptional regulator SutA | - |
QG303_RS08260 (QG303_08260) | 1775571..1775996 | - | 426 | WP_024014775.1 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
QG303_RS08265 (QG303_08265) | 1776211..1777548 | - | 1338 | WP_041476939.1 | ammonium transporter | - |
QG303_RS08270 (QG303_08270) | 1777586..1777924 | - | 339 | WP_002555808.1 | P-II family nitrogen regulator | - |
QG303_RS08275 (QG303_08275) | 1778319..1778579 | + | 261 | WP_122603430.1 | accessory factor UbiK family protein | - |
QG303_RS08280 (QG303_08280) | 1778693..1778998 | - | 306 | WP_039757791.1 | HigA family addiction module antitoxin | Antitoxin |
QG303_RS08285 (QG303_08285) | 1779006..1779284 | - | 279 | WP_281121056.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QG303_RS08290 (QG303_08290) | 1779610..1781103 | + | 1494 | WP_016772579.1 | YifB family Mg chelatase-like AAA ATPase | - |
QG303_RS08295 (QG303_08295) | 1781100..1782314 | - | 1215 | WP_122612288.1 | aldose 1-epimerase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | pilH / pilG / pilT / algR | 1585917..1782981 | 197064 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10415.98 Da Isoelectric Point: 7.7181
>T279210 WP_281121056.1 NZ_CP123909:c1779284-1779006 [Pseudomonas atacamensis]
MIVSFRCPETEYLFRSGKTRFWSAILSVAERKLTMLDAAAALADLRSPPGNRLESLGGDRKGQCSIRINAQWRICFLWGL
NGPEDVEIVDYH
MIVSFRCPETEYLFRSGKTRFWSAILSVAERKLTMLDAAAALADLRSPPGNRLESLGGDRKGQCSIRINAQWRICFLWGL
NGPEDVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|