Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mqsRA (relBE)/MqsR-MqsA
Location 5154267..5154637 Replicon chromosome
Accession NZ_CP123897
Organism Methylomonas sp. UP202

Toxin (Protein)


Gene name mqsR Uniprot ID -
Locus tag QC632_RS22775 Protein ID WP_281021639.1
Coordinates 5154512..5154637 (-) Length 42 a.a.

Antitoxin (Protein)


Gene name mqsA Uniprot ID -
Locus tag QC632_RS22770 Protein ID WP_281021638.1
Coordinates 5154267..5154509 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC632_RS22740 (QC632_22740) 5150607..5151200 + 594 WP_064029236.1 imidazoleglycerol-phosphate dehydratase HisB -
QC632_RS22745 (QC632_22745) 5151247..5151888 + 642 WP_064029234.1 imidazole glycerol phosphate synthase subunit HisH -
QC632_RS22750 (QC632_22750) 5151943..5152689 + 747 WP_064029231.1 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase -
QC632_RS22755 (QC632_22755) 5152700..5153473 + 774 WP_168028330.1 imidazole glycerol phosphate synthase subunit HisF -
QC632_RS22760 (QC632_22760) 5153470..5153856 + 387 WP_281021637.1 phosphoribosyl-AMP cyclohydrolase -
QC632_RS22770 (QC632_22770) 5154267..5154509 - 243 WP_281021638.1 type II toxin-antitoxin system MqsA family antitoxin Antitoxin
QC632_RS22775 (QC632_22775) 5154512..5154637 - 126 WP_281021639.1 type II toxin-antitoxin system MqsR family toxin Toxin
QC632_RS22780 (QC632_22780) 5154780..5155148 + 369 WP_281021640.1 hypothetical protein -
QC632_RS22785 (QC632_22785) 5155463..5155825 - 363 WP_281021641.1 Rap1a/Tai family immunity protein -
QC632_RS22790 (QC632_22790) 5155864..5156136 - 273 WP_281021642.1 hypothetical protein -
QC632_RS22795 (QC632_22795) 5156242..5156727 - 486 WP_281021643.1 hypothetical protein -
QC632_RS22800 (QC632_22800) 5156724..5157131 - 408 WP_281021644.1 DUF5681 domain-containing protein -
QC632_RS22805 (QC632_22805) 5157296..5159416 - 2121 WP_281021645.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 5153894..5163384 9490


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin MqsR

(1-40)

Antitoxin

Zinc finger, MqsA-type

(3-48)


Sequences

Toxin        


Download         Length: 42 a.a.        Molecular weight: 4787.59 Da        Isoelectric Point: 6.4463

>T279204 WP_281021639.1 NZ_CP123897:c5154637-5154512 [Methylomonas sp. UP202]
MTTHADHKVWQDIYRPKTLVGDVYLKLTVIDDVLVVSFKEL

Download         Length: 126 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8814.11 Da        Isoelectric Point: 4.4012

>AT279204 WP_281021638.1 NZ_CP123897:c5154509-5154267 [Methylomonas sp. UP202]
MKCPSCGAAELMKDTRDLEYTYKGESTVIPDVTGKFCPACDEVITDAEESRRTMALMMEFNKQVNASIVEPSFIASVPKS

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References