Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2335880..2336064 | Replicon | chromosome |
| Accession | NZ_CP123853 | ||
| Organism | Staphylococcus aureus strain FDA209P | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | NUG19_RS11415 | Protein ID | WP_000482647.1 |
| Coordinates | 2335880..2335987 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2336004..2336064 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG19_RS11390 | 2331252..2331725 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
| NUG19_RS11395 | 2331848..2333059 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| NUG19_RS11400 | 2333241..2333900 | - | 660 | WP_000831298.1 | membrane protein | - |
| NUG19_RS11405 | 2333960..2335102 | - | 1143 | WP_042727740.1 | glycerate kinase | - |
| NUG19_RS11410 | 2335360..2335746 | + | 387 | WP_000779360.1 | flippase GtxA | - |
| NUG19_RS11415 | 2335880..2335987 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 2336004..2336064 | - | 61 | - | - | Antitoxin |
| NUG19_RS11420 | 2336691..2338454 | + | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein | - |
| NUG19_RS11425 | 2338479..2340212 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
| NUG19_RS11430 | 2340443..2340610 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T279186 WP_000482647.1 NZ_CP123853:2335880-2335987 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT279186 NZ_CP123853:c2336064-2336004 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACTAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACTAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|