Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 19379..19717 | Replicon | chromosome |
Accession | NZ_CP123853 | ||
Organism | Staphylococcus aureus strain FDA209P |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | NUG19_RS00100 | Protein ID | WP_072353918.1 |
Coordinates | 19379..19555 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 19543..19717 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG19_RS00080 | 14546..18328 | + | 3783 | WP_042727565.1 | phage tail spike protein | - |
NUG19_RS00085 | 18321..18473 | + | 153 | WP_001000058.1 | hypothetical protein | - |
NUG19_RS00090 | 18519..18806 | + | 288 | WP_001262620.1 | hypothetical protein | - |
NUG19_RS00095 | 18862..19236 | + | 375 | WP_000340977.1 | hypothetical protein | - |
NUG19_RS00100 | 19379..19555 | + | 177 | WP_072353918.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 19543..19717 | - | 175 | - | - | Antitoxin |
NUG19_RS00110 | 19767..20021 | + | 255 | WP_000611512.1 | phage holin | - |
NUG19_RS00115 | 20033..20788 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
NUG19_RS00120 | 20979..21470 | + | 492 | WP_000920041.1 | staphylokinase | - |
NUG19_RS00125 | 22122..22457 | + | 336 | Protein_24 | SH3 domain-containing protein | - |
NUG19_RS00130 | 22967..23317 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
NUG19_RS00135 | 23370..23630 | - | 261 | WP_001791826.1 | hypothetical protein | - |
NUG19_RS00140 | 23941..24120 | - | 180 | WP_000669789.1 | hypothetical protein | - |
NUG19_RS00145 | 24492..24689 | - | 198 | WP_000239610.1 | phospholipase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sak / scn | 52..23317 | 23265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T279179 WP_072353918.1 NZ_CP123853:19379-19555 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT279179 NZ_CP123853:c19717-19543 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|