Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/- |
| Location | 1091302..1091957 | Replicon | chromosome |
| Accession | NZ_CP123771 | ||
| Organism | Pseudomonas viciae strain YsS1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QCD61_RS04685 | Protein ID | WP_092223719.1 |
| Coordinates | 1091302..1091646 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QCD61_RS04690 | Protein ID | WP_135843777.1 |
| Coordinates | 1091643..1091957 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCD61_RS04660 (QCD61_04660) | 1086317..1087264 | + | 948 | WP_256454288.1 | ubiquinol oxidase subunit II | - |
| QCD61_RS04665 (QCD61_04665) | 1087268..1089298 | + | 2031 | WP_135843774.1 | cytochrome o ubiquinol oxidase subunit I | - |
| QCD61_RS04670 (QCD61_04670) | 1089302..1089928 | + | 627 | WP_135843775.1 | cytochrome o ubiquinol oxidase subunit III | - |
| QCD61_RS04675 (QCD61_04675) | 1089929..1090264 | + | 336 | WP_025211927.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| QCD61_RS04680 (QCD61_04680) | 1090276..1091163 | + | 888 | WP_135843776.1 | heme o synthase | - |
| QCD61_RS04685 (QCD61_04685) | 1091302..1091646 | + | 345 | WP_092223719.1 | toxin | Toxin |
| QCD61_RS04690 (QCD61_04690) | 1091643..1091957 | + | 315 | WP_135843777.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QCD61_RS04695 (QCD61_04695) | 1092066..1092770 | - | 705 | WP_135843778.1 | hypothetical protein | - |
| QCD61_RS04700 (QCD61_04700) | 1092930..1093943 | - | 1014 | WP_135843779.1 | sensor domain-containing diguanylate cyclase | - |
| QCD61_RS04705 (QCD61_04705) | 1094043..1094960 | - | 918 | WP_280944699.1 | LysR family transcriptional regulator | - |
| QCD61_RS04710 (QCD61_04710) | 1095059..1096234 | + | 1176 | WP_265072718.1 | aspartate aminotransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13709.71 Da Isoelectric Point: 9.2887
>T279146 WP_092223719.1 NZ_CP123771:1091302-1091646 [Pseudomonas viciae]
MRTLFFETTTFTATVGHYLTDDEYRLLQSYMLQHPEVGDVMPRTGGFRKLRWFDERRGKGKRGGLRVIYYWLMNDRQFWM
FAIYDKDELENLTSEQEKTLKRAIEAELKVRGTL
MRTLFFETTTFTATVGHYLTDDEYRLLQSYMLQHPEVGDVMPRTGGFRKLRWFDERRGKGKRGGLRVIYYWLMNDRQFWM
FAIYDKDELENLTSEQEKTLKRAIEAELKVRGTL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|