Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 807..1392 | Replicon | plasmid pAP8900-3 |
| Accession | NZ_CP123768 | ||
| Organism | Acinetobacter pittii strain AP8900 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QFB56_RS20145 | Protein ID | WP_199953194.1 |
| Coordinates | 1072..1392 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QFB56_RS20140 | Protein ID | WP_000369783.1 |
| Coordinates | 807..1079 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB56_RS20140 (QFB56_20140) | 807..1079 | - | 273 | WP_000369783.1 | NadS family protein | Antitoxin |
| QFB56_RS20145 (QFB56_20145) | 1072..1392 | - | 321 | WP_199953194.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFB56_RS20150 (QFB56_20150) | 1625..2539 | + | 915 | WP_199953193.1 | Abi family protein | - |
| QFB56_RS20155 (QFB56_20155) | 2558..3199 | + | 642 | WP_199953192.1 | tetratricopeptide repeat protein | - |
| QFB56_RS20160 (QFB56_20160) | 3227..4873 | - | 1647 | WP_001094416.1 | IS66-like element ISAba17 family transposase | - |
| QFB56_RS20165 (QFB56_20165) | 4948..5283 | - | 336 | WP_000618090.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QFB56_RS20170 (QFB56_20170) | 5280..5708 | - | 429 | WP_000364662.1 | transposase | - |
| QFB56_RS20175 (QFB56_20175) | 5847..6236 | + | 390 | WP_199953189.1 | SEL1-like repeat protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..12558 | 12558 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12223.09 Da Isoelectric Point: 6.9809
>T279142 WP_199953194.1 NZ_CP123768:c1392-1072 [Acinetobacter pittii]
MLFIETSIFTKQIKELVSDDEYRELQQELLVQPDKGDLIKNGGGIRKVRCAQGSKGKSGGIRVIYYWITEDDQIFMLLAY
PKSVKENLTDKETTILRQLVKEQFHG
MLFIETSIFTKQIKELVSDDEYRELQQELLVQPDKGDLIKNGGGIRKVRCAQGSKGKSGGIRVIYYWITEDDQIFMLLAY
PKSVKENLTDKETTILRQLVKEQFHG
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|