Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe(toxin) |
| Location | 495650..496182 | Replicon | chromosome |
| Accession | NZ_CP123735 | ||
| Organism | Lactobacillus kefiranofaciens strain ZW18 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | A0A656YA18 |
| Locus tag | QEJ78_RS02410 | Protein ID | WP_013854119.1 |
| Coordinates | 495913..496182 (+) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | A0A656Y9W5 |
| Locus tag | QEJ78_RS02405 | Protein ID | WP_013854120.1 |
| Coordinates | 495650..495916 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEJ78_RS02380 (QEJ78_02385) | 491670..492085 | + | 416 | Protein_470 | cupin domain-containing protein | - |
| QEJ78_RS02385 (QEJ78_02390) | 492095..492412 | + | 318 | WP_025084192.1 | carboxymuconolactone decarboxylase family protein | - |
| QEJ78_RS02390 (QEJ78_02395) | 492471..493364 | + | 894 | WP_013854124.1 | DUF3737 family protein | - |
| QEJ78_RS02395 (QEJ78_02400) | 493370..494539 | + | 1170 | WP_013854123.1 | MalY/PatB family protein | - |
| QEJ78_RS02400 (QEJ78_02405) | 494536..495399 | + | 864 | WP_025084193.1 | alpha/beta hydrolase | - |
| QEJ78_RS02405 (QEJ78_02410) | 495650..495916 | + | 267 | WP_013854120.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QEJ78_RS02410 (QEJ78_02415) | 495913..496182 | + | 270 | WP_013854119.1 | Txe/YoeB family addiction module toxin | Toxin |
| QEJ78_RS02415 (QEJ78_02420) | 496368..497705 | + | 1338 | WP_025084196.1 | MATE family efflux transporter | - |
| QEJ78_RS02420 (QEJ78_02425) | 497823..499724 | + | 1902 | WP_013854117.1 | heavy metal translocating P-type ATPase | - |
| QEJ78_RS02425 (QEJ78_02430) | 499747..499977 | + | 231 | WP_013854116.1 | cation transporter | - |
| QEJ78_RS02430 (QEJ78_02435) | 499977..500528 | + | 552 | WP_013854115.1 | DNA-binding protein | - |
| QEJ78_RS02435 (QEJ78_02440) | 500547..501176 | + | 630 | WP_013854114.1 | Crp/Fnr family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10617.35 Da Isoelectric Point: 10.4670
>T279129 WP_013854119.1 NZ_CP123735:495913-496182 [Lactobacillus kefiranofaciens]
MILKYHGRIKNSAKPDLKKIKRSNLKDNFQDIIDQLKKDPYKKNQGFEKLEPPILGKYSRRINIKHRVVYTVDDVNKIVS
IYSAWSHYE
MILKYHGRIKNSAKPDLKKIKRSNLKDNFQDIIDQLKKDPYKKNQGFEKLEPPILGKYSRRINIKHRVVYTVDDVNKIVS
IYSAWSHYE
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656YA18 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656Y9W5 |