Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4606493..4607095 | Replicon | chromosome |
| Accession | NZ_CP123660 | ||
| Organism | Salmonella enterica subsp. enterica serovar Kentucky strain CVM N38232 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V7IUJ1 |
| Locus tag | DE22_RS22095 | Protein ID | WP_001159632.1 |
| Coordinates | 4606784..4607095 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | DE22_RS22090 | Protein ID | WP_000362050.1 |
| Coordinates | 4606493..4606783 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DE22_RS22075 (4603986) | 4603986..4604888 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| DE22_RS22080 (4604885) | 4604885..4605520 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| DE22_RS22085 (4605517) | 4605517..4606446 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| DE22_RS22090 (4606493) | 4606493..4606783 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| DE22_RS22095 (4606784) | 4606784..4607095 | - | 312 | WP_001159632.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| DE22_RS22100 (4607313) | 4607313..4608242 | + | 930 | WP_001127700.1 | alpha/beta hydrolase | - |
| DE22_RS22105 (4608328) | 4608328..4608639 | + | 312 | WP_000558164.1 | type II toxin-antitoxin system HigB family toxin | - |
| DE22_RS22110 (4608636) | 4608636..4609082 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| DE22_RS22115 (4609097) | 4609097..4610038 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| DE22_RS22120 (4610083) | 4610083..4610520 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| DE22_RS22125 (4610517) | 4610517..4611389 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| DE22_RS22130 (4611383) | 4611383..4611982 | - | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12342.27 Da Isoelectric Point: 9.4460
>T279126 WP_001159632.1 NZ_CP123660:c4607095-4606784 [Salmonella enterica subsp. enterica serovar Kentucky]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT279126 WP_000362050.1 NZ_CP123660:c4606783-4606493 [Salmonella enterica subsp. enterica serovar Kentucky]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|