Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4390835..4391481 | Replicon | chromosome |
Accession | NZ_CP123642 | ||
Organism | Klebsiella pneumoniae strain KpBSB53 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A486UPU4 |
Locus tag | QFW99_RS21985 | Protein ID | WP_032417639.1 |
Coordinates | 4390835..4391182 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | QFW99_RS21990 | Protein ID | WP_002920557.1 |
Coordinates | 4391182..4391481 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFW99_RS21975 (4386761) | 4386761..4388194 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
QFW99_RS21980 (4388212) | 4388212..4390659 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
QFW99_RS21985 (4390835) | 4390835..4391182 | + | 348 | WP_032417639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QFW99_RS21990 (4391182) | 4391182..4391481 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QFW99_RS21995 (4391544) | 4391544..4393052 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
QFW99_RS22000 (4393257) | 4393257..4393586 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
QFW99_RS22005 (4393637) | 4393637..4394467 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
QFW99_RS22010 (4394517) | 4394517..4395275 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13527.52 Da Isoelectric Point: 5.6802
>T279108 WP_032417639.1 NZ_CP123642:4390835-4391182 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATILILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFEPLRKAI
VLCAGDKDGMNEKRFYKELITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATILILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFEPLRKAI
VLCAGDKDGMNEKRFYKELITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A486UPU4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |