279107

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4364646..4365232 Replicon chromosome
Accession NZ_CP123642
Organism Klebsiella pneumoniae strain KpBSB53

Toxin (Protein)


Gene name doc Uniprot ID A0A485R3H6
Locus tag QFW99_RS21875 Protein ID WP_032417643.1
Coordinates 4364864..4365232 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QFW99_RS21870 Protein ID WP_004174006.1
Coordinates 4364646..4364867 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFW99_RS21850 (4360803) 4360803..4361729 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QFW99_RS21855 (4361726) 4361726..4363003 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
QFW99_RS21860 (4363000) 4363000..4363767 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QFW99_RS21865 (4363769) 4363769..4364482 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QFW99_RS21870 (4364646) 4364646..4364867 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QFW99_RS21875 (4364864) 4364864..4365232 + 369 WP_032417643.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QFW99_RS21880 (4365505) 4365505..4366821 + 1317 WP_032417642.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QFW99_RS21885 (4366928) 4366928..4367815 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QFW99_RS21890 (4367812) 4367812..4368657 + 846 WP_032416348.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QFW99_RS21895 (4368659) 4368659..4369729 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4361726..4370466 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13584.98 Da        Isoelectric Point: 8.6410

>T279107 WP_032417643.1 NZ_CP123642:4364864-4365232 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRMLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT279107 WP_004174006.1 NZ_CP123642:4364646-4364867 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A485R3H6

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References