Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 4364646..4365232 | Replicon | chromosome |
| Accession | NZ_CP123642 | ||
| Organism | Klebsiella pneumoniae strain KpBSB53 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A485R3H6 |
| Locus tag | QFW99_RS21875 | Protein ID | WP_032417643.1 |
| Coordinates | 4364864..4365232 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | QFW99_RS21870 | Protein ID | WP_004174006.1 |
| Coordinates | 4364646..4364867 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFW99_RS21850 (4360803) | 4360803..4361729 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QFW99_RS21855 (4361726) | 4361726..4363003 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| QFW99_RS21860 (4363000) | 4363000..4363767 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| QFW99_RS21865 (4363769) | 4363769..4364482 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| QFW99_RS21870 (4364646) | 4364646..4364867 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QFW99_RS21875 (4364864) | 4364864..4365232 | + | 369 | WP_032417643.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QFW99_RS21880 (4365505) | 4365505..4366821 | + | 1317 | WP_032417642.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| QFW99_RS21885 (4366928) | 4366928..4367815 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| QFW99_RS21890 (4367812) | 4367812..4368657 | + | 846 | WP_032416348.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| QFW99_RS21895 (4368659) | 4368659..4369729 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 4361726..4370466 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13584.98 Da Isoelectric Point: 8.6410
>T279107 WP_032417643.1 NZ_CP123642:4364864-4365232 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRMLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRMLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A485R3H6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |