Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1524804..1525464 | Replicon | chromosome |
Accession | NZ_CP123607 | ||
Organism | Serratia marcescens strain RMCH-M16-N |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QFB85_RS07155 | Protein ID | WP_031300708.1 |
Coordinates | 1524804..1525157 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QFB85_RS07160 | Protein ID | WP_280631408.1 |
Coordinates | 1525162..1525464 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB85_RS07135 (QFB85_07135) | 1520893..1521258 | + | 366 | WP_004935528.1 | diacylglycerol kinase | - |
QFB85_RS07140 (QFB85_07140) | 1521363..1522262 | + | 900 | WP_280631406.1 | LysR family transcriptional regulator | - |
QFB85_RS07145 (QFB85_07145) | 1522237..1523043 | - | 807 | WP_280631407.1 | substrate-binding domain-containing protein | - |
QFB85_RS07150 (QFB85_07150) | 1523070..1524365 | - | 1296 | WP_004935508.1 | MFS transporter | - |
QFB85_RS07155 (QFB85_07155) | 1524804..1525157 | + | 354 | WP_031300708.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QFB85_RS07160 (QFB85_07160) | 1525162..1525464 | + | 303 | WP_280631408.1 | XRE family transcriptional regulator | Antitoxin |
QFB85_RS07165 (QFB85_07165) | 1525587..1526495 | - | 909 | WP_004935498.1 | LysR family transcriptional regulator | - |
QFB85_RS07170 (QFB85_07170) | 1526634..1527554 | + | 921 | WP_031300707.1 | alpha/beta hydrolase | - |
QFB85_RS07175 (QFB85_07175) | 1527554..1528489 | + | 936 | WP_280631410.1 | alpha/beta hydrolase | - |
QFB85_RS07180 (QFB85_07180) | 1528506..1529141 | + | 636 | WP_004935489.1 | SDR family oxidoreductase | - |
QFB85_RS07185 (QFB85_07185) | 1529184..1529912 | + | 729 | WP_280631411.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1506095..1532659 | 26564 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13609.61 Da Isoelectric Point: 9.0493
>T279084 WP_031300708.1 NZ_CP123607:1524804-1525157 [Serratia marcescens]
VWEIKTTDAFDHWFRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGM
VLCAGNKAGDEKRFYDRMLQIADREFTNWLNTLKEKE
VWEIKTTDAFDHWFRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGM
VLCAGNKAGDEKRFYDRMLQIADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|