Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 784381..785033 | Replicon | chromosome |
| Accession | NZ_CP123607 | ||
| Organism | Serratia marcescens strain RMCH-M16-N | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QFB85_RS03685 | Protein ID | WP_280631246.1 |
| Coordinates | 784689..785033 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QFB85_RS03680 | Protein ID | WP_280631245.1 |
| Coordinates | 784381..784683 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB85_RS03655 (QFB85_03655) | 779383..780030 | - | 648 | WP_004931818.1 | DsbA family protein | - |
| QFB85_RS03660 (QFB85_03660) | 780105..780989 | - | 885 | WP_280631242.1 | MBL fold metallo-hydrolase | - |
| QFB85_RS03665 (QFB85_03665) | 781098..782006 | + | 909 | WP_015378928.1 | LysR family transcriptional regulator | - |
| QFB85_RS03670 (QFB85_03670) | 782034..782957 | - | 924 | WP_280631243.1 | LysR family transcriptional regulator | - |
| QFB85_RS03675 (QFB85_03675) | 783091..784353 | + | 1263 | WP_280631244.1 | diaminopimelate decarboxylase | - |
| QFB85_RS03680 (QFB85_03680) | 784381..784683 | - | 303 | WP_280631245.1 | XRE family transcriptional regulator | Antitoxin |
| QFB85_RS03685 (QFB85_03685) | 784689..785033 | - | 345 | WP_280631246.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFB85_RS03690 (QFB85_03690) | 785191..786210 | - | 1020 | WP_004931832.1 | HTH-type transcriptional regulator GalR | - |
| QFB85_RS03695 (QFB85_03695) | 786431..788689 | + | 2259 | WP_280631247.1 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13341.36 Da Isoelectric Point: 10.6087
>T279082 WP_280631246.1 NZ_CP123607:c785033-784689 [Serratia marcescens]
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRGFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
MWQVVTVERFDDWFLALNNAQQTSILAAIYKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRGFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|