Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 1212710..1213312 | Replicon | chromosome |
Accession | NZ_CP123598 | ||
Organism | Enterobacter cloacae strain RMCH-M23-N |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A5E1AN02 |
Locus tag | QFB83_RS05915 | Protein ID | WP_013099360.1 |
Coordinates | 1213001..1213312 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QFB83_RS05910 | Protein ID | WP_013099359.1 |
Coordinates | 1212710..1213000 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB83_RS05895 (QFB83_05895) | 1210207..1211109 | + | 903 | WP_014833793.1 | formate dehydrogenase subunit beta | - |
QFB83_RS05900 (QFB83_05900) | 1211106..1211741 | + | 636 | WP_013099357.1 | formate dehydrogenase cytochrome b556 subunit | - |
QFB83_RS05905 (QFB83_05905) | 1211738..1212667 | + | 930 | WP_280597093.1 | formate dehydrogenase accessory protein FdhE | - |
QFB83_RS05910 (QFB83_05910) | 1212710..1213000 | - | 291 | WP_013099359.1 | helix-turn-helix domain-containing protein | Antitoxin |
QFB83_RS05915 (QFB83_05915) | 1213001..1213312 | - | 312 | WP_013099360.1 | hypothetical protein | Toxin |
QFB83_RS05920 (QFB83_05920) | 1213542..1214459 | + | 918 | WP_280597096.1 | alpha/beta hydrolase | - |
QFB83_RS05925 (QFB83_05925) | 1214472..1215413 | - | 942 | WP_057072637.1 | fatty acid biosynthesis protein FabY | - |
QFB83_RS05930 (QFB83_05930) | 1215458..1215895 | - | 438 | WP_013099363.1 | D-aminoacyl-tRNA deacylase | - |
QFB83_RS05935 (QFB83_05935) | 1215892..1216773 | - | 882 | WP_013099364.1 | virulence factor BrkB family protein | - |
QFB83_RS05940 (QFB83_05940) | 1216767..1217366 | - | 600 | WP_013099365.1 | glucose-1-phosphatase | - |
QFB83_RS05945 (QFB83_05945) | 1217486..1218286 | - | 801 | WP_013099366.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12210.18 Da Isoelectric Point: 9.7550
>T279065 WP_013099360.1 NZ_CP123598:c1213312-1213001 [Enterobacter cloacae]
MLFIETDIFTEDVKTLLDDDEYHKLQVFLATQPDYGDLIQNTGGLRKIRWLSGGRGKRGGVRVIYFHRTHEFEIRLLLIY
RKGIKDDLSAREKAILKKMIERW
MLFIETDIFTEDVKTLLDDDEYHKLQVFLATQPDYGDLIQNTGGLRKIRWLSGGRGKRGGVRVIYFHRTHEFEIRLLLIY
RKGIKDDLSAREKAILKKMIERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|