Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2577426..2578074 | Replicon | chromosome |
| Accession | NZ_CP123597 | ||
| Organism | Serratia marcescens strain RMCH-M26-N | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QFB82_RS12530 | Protein ID | WP_280598412.1 |
| Coordinates | 2577733..2578074 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2V4GQ69 |
| Locus tag | QFB82_RS12525 | Protein ID | WP_033635213.1 |
| Coordinates | 2577426..2577728 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB82_RS12505 (QFB82_12505) | 2573053..2573967 | - | 915 | WP_004928592.1 | branched-chain amino acid ABC transporter permease | - |
| QFB82_RS12510 (QFB82_12510) | 2574091..2575209 | - | 1119 | WP_033632602.1 | branched-chain amino acid ABC transporter substrate-binding protein | - |
| QFB82_RS12520 (QFB82_12520) | 2575792..2577000 | - | 1209 | WP_280598411.1 | aldose 1-epimerase family protein | - |
| QFB82_RS12525 (QFB82_12525) | 2577426..2577728 | - | 303 | WP_033635213.1 | XRE family transcriptional regulator | Antitoxin |
| QFB82_RS12530 (QFB82_12530) | 2577733..2578074 | - | 342 | WP_280598412.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFB82_RS12535 (QFB82_12535) | 2578513..2579808 | + | 1296 | WP_033632599.1 | MFS transporter | - |
| QFB82_RS12540 (QFB82_12540) | 2579835..2580641 | + | 807 | WP_261440864.1 | substrate-binding domain-containing protein | - |
| QFB82_RS12545 (QFB82_12545) | 2580616..2581515 | - | 900 | WP_280598413.1 | LysR family transcriptional regulator | - |
| QFB82_RS12550 (QFB82_12550) | 2581619..2582104 | - | 486 | WP_228392530.1 | diacylglycerol kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13306.34 Da Isoelectric Point: 9.8278
>T279057 WP_280598412.1 NZ_CP123597:c2578074-2577733 [Serratia marcescens]
VWEIKTTDAFDHWFRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQRRGEPLRAFFAFDPYRVGM
VLCAGNKKRFYDRMLQIVDREFTNWLNTLNEKE
VWEIKTTDAFDHWFRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQRRGEPLRAFFAFDPYRVGM
VLCAGNKKRFYDRMLQIVDREFTNWLNTLNEKE
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|