Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 1882909..1883530 Replicon chromosome
Accession NZ_CP123499
Organism Arsenophonus sp. aPb

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QE177_RS08445 Protein ID WP_280548710.1
Coordinates 1882909..1883238 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QE177_RS08450 Protein ID WP_280548712.1
Coordinates 1883228..1883530 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE177_RS08410 (QE177_08410) 1879163..1879498 - 336 WP_280548696.1 hypothetical protein -
QE177_RS08415 (QE177_08415) 1879705..1880346 - 642 WP_280548698.1 bacteriophage antitermination protein Q -
QE177_RS08420 (QE177_08420) 1880357..1880851 - 495 WP_280548700.1 DUF968 domain-containing protein -
QE177_RS08425 (QE177_08425) 1880848..1881504 - 657 WP_280548702.1 phage N-6-adenine-methyltransferase -
QE177_RS08430 (QE177_08430) 1881504..1881704 - 201 WP_280548704.1 hypothetical protein -
QE177_RS08435 (QE177_08435) 1881695..1882294 - 600 WP_280548706.1 conserved phage C-terminal domain-containing protein -
QE177_RS08440 (QE177_08440) 1882442..1882783 - 342 WP_280548708.1 hypothetical protein -
QE177_RS08445 (QE177_08445) 1882909..1883238 + 330 WP_280548710.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QE177_RS08450 (QE177_08450) 1883228..1883530 + 303 WP_280548712.1 helix-turn-helix transcriptional regulator Antitoxin
QE177_RS08455 (QE177_08455) 1883625..1883888 - 264 WP_280548714.1 DUF4222 domain-containing protein -
QE177_RS08460 (QE177_08460) 1883971..1884494 - 524 Protein_1632 YmfL family putative regulatory protein -
QE177_RS08465 (QE177_08465) 1884527..1884754 - 228 WP_280548716.1 Cro/CI family transcriptional regulator -
QE177_RS08470 (QE177_08470) 1884855..1885148 + 294 WP_280548719.1 helix-turn-helix domain-containing protein -
QE177_RS08475 (QE177_08475) 1885145..1885345 + 201 WP_280548721.1 hypothetical protein -
QE177_RS08480 (QE177_08480) 1885700..1885978 + 279 WP_280548723.1 hypothetical protein -
QE177_RS08485 (QE177_08485) 1886351..1886815 - 465 WP_280548725.1 hypothetical protein -
QE177_RS08490 (QE177_08490) 1887273..1887632 + 360 WP_280548727.1 hypothetical protein -
QE177_RS08495 (QE177_08495) 1887691..1888521 + 831 Protein_1639 DUF2303 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(14-103)

Antitoxin

Cro/C1-type helix-turn-helix domain

(38-92)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12787.95 Da        Isoelectric Point: 9.9501

>T279009 WP_280548710.1 NZ_CP123499:1882909-1883238 [Arsenophonus sp. aPb]
MKYTIEYYSEEVEKDILSLPDTIQARYIRYTEKMRIYGANLGEPHTSSFGDGLFELRLKGCEGIGRVFYCTLIGKRIVML
HSFIKKTNKTPIKERQKAEKRLKEVKYGK

Download         Length: 330 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 10984.87 Da        Isoelectric Point: 10.5338

>AT279009 WP_280548712.1 NZ_CP123499:1883228-1883530 [Arsenophonus sp. aPb]
MANKRTMMTHDELVEKMLSNPKVKAEYDAIAEEFALLDEILAARKNAGLTQEQLAKRMGTKATAITRMESNLASGVSGPS
FSTLKKLAKATGKKLQIRFV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References