Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 1301671..1302298 | Replicon | chromosome |
| Accession | NZ_CP123498 | ||
| Organism | Arsenophonus nasoniae strain aIh | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QE207_RS08300 | Protein ID | WP_280630001.1 |
| Coordinates | 1301969..1302298 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QE207_RS08295 | Protein ID | WP_280630000.1 |
| Coordinates | 1301671..1301979 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE207_RS08250 (QE207_08245) | 1297076..1297435 | - | 360 | WP_280629808.1 | hypothetical protein | - |
| QE207_RS08255 (QE207_08250) | 1297976..1298413 | - | 438 | WP_280629995.1 | hypothetical protein | - |
| QE207_RS08260 (QE207_08255) | 1298708..1298890 | + | 183 | WP_280629810.1 | hypothetical protein | - |
| QE207_RS08265 (QE207_08260) | 1298868..1299029 | - | 162 | WP_280629811.1 | hypothetical protein | - |
| QE207_RS08270 (QE207_08265) | 1299228..1299506 | - | 279 | WP_280629996.1 | hypothetical protein | - |
| QE207_RS08275 (QE207_08270) | 1299713..1300366 | - | 654 | WP_280629997.1 | S24 family peptidase | - |
| QE207_RS08280 (QE207_08275) | 1300452..1300679 | + | 228 | WP_280629998.1 | Cro/CI family transcriptional regulator | - |
| QE207_RS08285 (QE207_08280) | 1300712..1301170 | + | 459 | Protein_1218 | YmfL family putative regulatory protein | - |
| QE207_RS08290 (QE207_08285) | 1301238..1301576 | + | 339 | WP_280629999.1 | DUF4222 domain-containing protein | - |
| QE207_RS08295 (QE207_08290) | 1301671..1301979 | - | 309 | WP_280630000.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QE207_RS08300 (QE207_08295) | 1301969..1302298 | - | 330 | WP_280630001.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QE207_RS08305 (QE207_08300) | 1302424..1303524 | + | 1101 | WP_280630002.1 | conserved phage C-terminal domain-containing protein | - |
| QE207_RS08310 (QE207_08305) | 1303515..1303715 | + | 201 | WP_280630003.1 | hypothetical protein | - |
| QE207_RS08315 (QE207_08310) | 1303724..1304371 | + | 648 | WP_280630258.1 | phage N-6-adenine-methyltransferase | - |
| QE207_RS08320 (QE207_08315) | 1304454..1304693 | + | 240 | WP_280630004.1 | hypothetical protein | - |
| QE207_RS08325 (QE207_08320) | 1304697..1304948 | + | 252 | WP_280630259.1 | DUF968 domain-containing protein | - |
| QE207_RS08330 (QE207_08325) | 1304990..1305649 | + | 660 | WP_280630005.1 | bacteriophage antitermination protein Q | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1246056..1339809 | 93753 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12669.79 Da Isoelectric Point: 9.9623
>T279001 WP_280630001.1 NZ_CP123498:c1302298-1301969 [Arsenophonus nasoniae]
MKYTIEYYSEEVRTEIEQLPTSMRVRYTHLVERMKVYGGNLGEPHTSPFGDGLFELRIKSSNGIGRVFYCTLIGKCIVIL
HSFVKKTQKTPVGDLKKAKTRMKEVKHDW
MKYTIEYYSEEVRTEIEQLPTSMRVRYTHLVERMKVYGGNLGEPHTSPFGDGLFELRIKSSNGIGRVFYCTLIGKCIVIL
HSFVKKTQKTPVGDLKKAKTRMKEVKHDW
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|