Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 1301671..1302298 Replicon chromosome
Accession NZ_CP123498
Organism Arsenophonus nasoniae strain aIh

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QE207_RS08300 Protein ID WP_280630001.1
Coordinates 1301969..1302298 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QE207_RS08295 Protein ID WP_280630000.1
Coordinates 1301671..1301979 (-) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE207_RS08250 (QE207_08245) 1297076..1297435 - 360 WP_280629808.1 hypothetical protein -
QE207_RS08255 (QE207_08250) 1297976..1298413 - 438 WP_280629995.1 hypothetical protein -
QE207_RS08260 (QE207_08255) 1298708..1298890 + 183 WP_280629810.1 hypothetical protein -
QE207_RS08265 (QE207_08260) 1298868..1299029 - 162 WP_280629811.1 hypothetical protein -
QE207_RS08270 (QE207_08265) 1299228..1299506 - 279 WP_280629996.1 hypothetical protein -
QE207_RS08275 (QE207_08270) 1299713..1300366 - 654 WP_280629997.1 S24 family peptidase -
QE207_RS08280 (QE207_08275) 1300452..1300679 + 228 WP_280629998.1 Cro/CI family transcriptional regulator -
QE207_RS08285 (QE207_08280) 1300712..1301170 + 459 Protein_1218 YmfL family putative regulatory protein -
QE207_RS08290 (QE207_08285) 1301238..1301576 + 339 WP_280629999.1 DUF4222 domain-containing protein -
QE207_RS08295 (QE207_08290) 1301671..1301979 - 309 WP_280630000.1 helix-turn-helix transcriptional regulator Antitoxin
QE207_RS08300 (QE207_08295) 1301969..1302298 - 330 WP_280630001.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QE207_RS08305 (QE207_08300) 1302424..1303524 + 1101 WP_280630002.1 conserved phage C-terminal domain-containing protein -
QE207_RS08310 (QE207_08305) 1303515..1303715 + 201 WP_280630003.1 hypothetical protein -
QE207_RS08315 (QE207_08310) 1303724..1304371 + 648 WP_280630258.1 phage N-6-adenine-methyltransferase -
QE207_RS08320 (QE207_08315) 1304454..1304693 + 240 WP_280630004.1 hypothetical protein -
QE207_RS08325 (QE207_08320) 1304697..1304948 + 252 WP_280630259.1 DUF968 domain-containing protein -
QE207_RS08330 (QE207_08325) 1304990..1305649 + 660 WP_280630005.1 bacteriophage antitermination protein Q -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1246056..1339809 93753


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(15-103)

Antitoxin

Cro/C1-type helix-turn-helix domain

(45-94)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12669.79 Da        Isoelectric Point: 9.9623

>T279001 WP_280630001.1 NZ_CP123498:c1302298-1301969 [Arsenophonus nasoniae]
MKYTIEYYSEEVRTEIEQLPTSMRVRYTHLVERMKVYGGNLGEPHTSPFGDGLFELRIKSSNGIGRVFYCTLIGKCIVIL
HSFVKKTQKTPVGDLKKAKTRMKEVKHDW

Download         Length: 330 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11274.25 Da        Isoelectric Point: 10.4856

>AT279001 WP_280630000.1 NZ_CP123498:c1301979-1301671 [Arsenophonus nasoniae]
MTGKRISPKMTHDEMVAKWMKDPAFKAEYDAIEEEFALLDEILLARKKAGLTQAQLAERMGTKATAITRMESNLASGVSG
PSFSTLKKLAKATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References