Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 556339..556960 | Replicon | chromosome |
Accession | NZ_CP123498 | ||
Organism | Arsenophonus nasoniae strain aIh |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QE207_RS04515 | Protein ID | WP_280548710.1 |
Coordinates | 556339..556668 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QE207_RS04520 | Protein ID | WP_280548712.1 |
Coordinates | 556658..556960 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE207_RS04485 (QE207_04480) | 551773..552276 | - | 504 | WP_280629593.1 | hypothetical protein | - |
QE207_RS04490 (QE207_04485) | 552312..552833 | - | 522 | WP_280629594.1 | hypothetical protein | - |
QE207_RS04495 (QE207_04490) | 553099..553802 | - | 704 | Protein_487 | IS6 family transposase | - |
QE207_RS04500 (QE207_04495) | 553882..554352 | - | 471 | WP_280629595.1 | hypothetical protein | - |
QE207_RS04505 (QE207_04500) | 554799..555482 | + | 684 | Protein_489 | IS6 family transposase | - |
QE207_RS04510 (QE207_04505) | 555491..556213 | - | 723 | WP_280629596.1 | conserved phage C-terminal domain-containing protein | - |
QE207_RS04515 (QE207_04510) | 556339..556668 | + | 330 | WP_280548710.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QE207_RS04520 (QE207_04515) | 556658..556960 | + | 303 | WP_280548712.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QE207_RS04525 (QE207_04520) | 557046..557729 | - | 684 | WP_280629597.1 | IS6 family transposase | - |
QE207_RS04530 (QE207_04525) | 558074..558352 | - | 279 | WP_280629598.1 | helix-turn-helix transcriptional regulator | - |
QE207_RS04535 (QE207_04530) | 558650..559582 | + | 933 | WP_280629599.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
QE207_RS04540 (QE207_04535) | 559867..560034 | + | 168 | WP_280629600.1 | hypothetical protein | - |
QE207_RS04545 (QE207_04540) | 560031..560321 | + | 291 | WP_280629601.1 | transcriptional regulator | - |
QE207_RS04550 (QE207_04545) | 561063..561332 | + | 270 | WP_280629602.1 | Cox family DNA-binding protein | - |
QE207_RS04555 (QE207_04550) | 561320..561475 | + | 156 | WP_280629603.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 520832..595437 | 74605 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12787.95 Da Isoelectric Point: 9.9501
>T278999 WP_280548710.1 NZ_CP123498:556339-556668 [Arsenophonus nasoniae]
MKYTIEYYSEEVEKDILSLPDTIQARYIRYTEKMRIYGANLGEPHTSSFGDGLFELRLKGCEGIGRVFYCTLIGKRIVML
HSFIKKTNKTPIKERQKAEKRLKEVKYGK
MKYTIEYYSEEVEKDILSLPDTIQARYIRYTEKMRIYGANLGEPHTSSFGDGLFELRLKGCEGIGRVFYCTLIGKRIVML
HSFIKKTNKTPIKERQKAEKRLKEVKYGK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|