Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 323579..324165 Replicon chromosome
Accession NZ_CP123430
Organism Klebsiella pneumoniae strain SH22PE16

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QEZ34_RS01500 Protein ID WP_002920800.1
Coordinates 323797..324165 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QEZ34_RS01495 Protein ID WP_004174006.1
Coordinates 323579..323800 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEZ34_RS01475 (319736) 319736..320662 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QEZ34_RS01480 (320659) 320659..321936 + 1278 WP_023283043.1 branched chain amino acid ABC transporter permease LivM -
QEZ34_RS01485 (321933) 321933..322700 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QEZ34_RS01490 (322702) 322702..323415 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QEZ34_RS01495 (323579) 323579..323800 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QEZ34_RS01500 (323797) 323797..324165 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QEZ34_RS01505 (324438) 324438..325754 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QEZ34_RS01510 (325861) 325861..326748 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QEZ34_RS01515 (326745) 326745..327590 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QEZ34_RS01520 (327592) 327592..328662 + 1071 WP_004188298.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 320659..329399 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T278973 WP_002920800.1 NZ_CP123430:323797-324165 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT278973 WP_004174006.1 NZ_CP123430:323579-323800 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References