Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3671042..3671264 | Replicon | chromosome |
| Accession | NZ_CP123365 | ||
| Organism | Shigella flexneri strain MMGSG_23 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | PFB08_RS18705 | Protein ID | WP_001295224.1 |
| Coordinates | 3671042..3671149 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3671198..3671264 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PFB08_RS18675 | 3666071..3667642 | + | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| PFB08_RS18680 | 3667639..3667830 | + | 192 | WP_000988299.1 | cellulose biosynthesis protein BcsF | - |
| PFB08_RS18685 | 3667827..3669506 | + | 1680 | WP_000191557.1 | cellulose biosynthesis protein BcsG | - |
| PFB08_RS18690 | 3669593..3669700 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 3669757..3669812 | + | 56 | NuclAT_26 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_26 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_26 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_26 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_29 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_29 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_29 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_29 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_32 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_32 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_32 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_32 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_35 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_35 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_35 | - | - |
| - | 3669757..3669812 | + | 56 | NuclAT_35 | - | - |
| - | 3669757..3669814 | + | 58 | NuclAT_20 | - | - |
| - | 3669757..3669814 | + | 58 | NuclAT_20 | - | - |
| - | 3669757..3669814 | + | 58 | NuclAT_20 | - | - |
| - | 3669757..3669814 | + | 58 | NuclAT_20 | - | - |
| - | 3669757..3669814 | + | 58 | NuclAT_23 | - | - |
| - | 3669757..3669814 | + | 58 | NuclAT_23 | - | - |
| - | 3669757..3669814 | + | 58 | NuclAT_23 | - | - |
| - | 3669757..3669814 | + | 58 | NuclAT_23 | - | - |
| PFB08_RS18695 | 3670076..3670183 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 3670240..3670295 | + | 56 | NuclAT_28 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_28 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_28 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_28 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_31 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_31 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_31 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_31 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_34 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_34 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_34 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_34 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_37 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_37 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_37 | - | - |
| - | 3670240..3670295 | + | 56 | NuclAT_37 | - | - |
| - | 3670240..3670297 | + | 58 | NuclAT_22 | - | - |
| - | 3670240..3670297 | + | 58 | NuclAT_22 | - | - |
| - | 3670240..3670297 | + | 58 | NuclAT_22 | - | - |
| - | 3670240..3670297 | + | 58 | NuclAT_22 | - | - |
| - | 3670240..3670297 | + | 58 | NuclAT_25 | - | - |
| - | 3670240..3670297 | + | 58 | NuclAT_25 | - | - |
| - | 3670240..3670297 | + | 58 | NuclAT_25 | - | - |
| - | 3670240..3670297 | + | 58 | NuclAT_25 | - | - |
| PFB08_RS18700 | 3670559..3670666 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | - |
| - | 3670724..3670778 | + | 55 | NuclAT_27 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_27 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_27 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_27 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_30 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_30 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_30 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_30 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_33 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_33 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_33 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_33 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_36 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_36 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_36 | - | - |
| - | 3670724..3670778 | + | 55 | NuclAT_36 | - | - |
| - | 3670724..3670780 | + | 57 | NuclAT_21 | - | - |
| - | 3670724..3670780 | + | 57 | NuclAT_21 | - | - |
| - | 3670724..3670780 | + | 57 | NuclAT_21 | - | - |
| - | 3670724..3670780 | + | 57 | NuclAT_21 | - | - |
| - | 3670724..3670780 | + | 57 | NuclAT_24 | - | - |
| - | 3670724..3670780 | + | 57 | NuclAT_24 | - | - |
| - | 3670724..3670780 | + | 57 | NuclAT_24 | - | - |
| - | 3670724..3670780 | + | 57 | NuclAT_24 | - | - |
| PFB08_RS18705 | 3671042..3671149 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3671198..3671264 | + | 67 | - | - | Antitoxin |
| PFB08_RS18710 | 3671625..3672896 | + | 1272 | WP_005052340.1 | aromatic amino acid transport family protein | - |
| PFB08_RS18715 | 3672926..3673930 | - | 1005 | WP_000107041.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| PFB08_RS18720 | 3673927..3674910 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| PFB08_RS18725 | 3674921..3675823 | - | 903 | WP_000084666.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T278960 WP_001295224.1 NZ_CP123365:c3671149-3671042 [Shigella flexneri]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT278960 NZ_CP123365:3671198-3671264 [Shigella flexneri]
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|