Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3223964..3224691 | Replicon | chromosome |
Accession | NZ_CP123365 | ||
Organism | Shigella flexneri strain MMGSG_23 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | PFB08_RS16410 | Protein ID | WP_000550189.1 |
Coordinates | 3224377..3224691 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PFB08_RS16405 | Protein ID | WP_000560266.1 |
Coordinates | 3223964..3224380 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PFB08_RS16395 (3219324) | 3219324..3221675 | + | 2352 | WP_000695506.1 | alpha-glucosidase | - |
PFB08_RS16400 (3221901) | 3221901..3223919 | + | 2019 | WP_000121487.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
PFB08_RS16405 (3223964) | 3223964..3224380 | - | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
PFB08_RS16410 (3224377) | 3224377..3224691 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
PFB08_RS16415 (3224976) | 3224976..3226112 | - | 1137 | WP_000018656.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
PFB08_RS16420 (3226197) | 3226197..3226700 | + | 504 | WP_005050988.1 | M48 family metallopeptidase | - |
PFB08_RS16425 (3226777) | 3226777..3227469 | + | 693 | WP_000942538.1 | vancomycin high temperature exclusion protein | - |
PFB08_RS16430 (3227548) | 3227548..3228546 | + | 999 | WP_005050984.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T278958 WP_000550189.1 NZ_CP123365:c3224691-3224377 [Shigella flexneri]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT278958 WP_000560266.1 NZ_CP123365:c3224380-3223964 [Shigella flexneri]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|