Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2063981..2064206 Replicon chromosome
Accession NZ_CP123365
Organism Shigella flexneri strain MMGSG_23

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag PFB08_RS10765 Protein ID WP_000813254.1
Coordinates 2063981..2064136 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2064148..2064206 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PFB08_RS10710 2059296..2059643 - 348 WP_000631704.1 IS66 family insertion sequence element accessory protein TnpB -
PFB08_RS10715 2059640..2060314 - 675 WP_001088287.1 IS66-like element accessory protein TnpA -
PFB08_RS10720 2060413..2060628 - 216 WP_000839572.1 class II holin family protein -
PFB08_RS10745 2061424..2062112 - 689 Protein_2099 bacteriophage antitermination protein Q -
PFB08_RS10750 2062109..2062474 - 366 WP_000140020.1 RusA family crossover junction endodeoxyribonuclease -
PFB08_RS10755 2062475..2063533 - 1059 WP_001265248.1 DUF968 domain-containing protein -
PFB08_RS10760 2063535..2063813 - 279 WP_011069426.1 hypothetical protein -
PFB08_RS10765 2063981..2064136 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2064148..2064206 + 59 - - Antitoxin
PFB08_RS10770 2064788..2065204 - 417 WP_005069274.1 hypothetical protein -
PFB08_RS10775 2065231..2065371 + 141 Protein_2105 DUF4224 domain-containing protein -
PFB08_RS10780 2065371..2066421 + 1051 Protein_2106 tyrosine-type recombinase/integrase -
PFB08_RS10790 2066632..2067429 + 798 WP_001325918.1 DgsA anti-repressor MtfA -
PFB08_RS10800 2067767..2069028 + 1262 Protein_2108 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH9.8 2045222..2091085 45863


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T278955 WP_000813254.1 NZ_CP123365:c2064136-2063981 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT278955 NZ_CP123365:2064148-2064206 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References