Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1397783..1398008 | Replicon | chromosome |
| Accession | NZ_CP123365 | ||
| Organism | Shigella flexneri strain MMGSG_23 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | PFB08_RS07095 | Protein ID | WP_000813254.1 |
| Coordinates | 1397853..1398008 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1397783..1397841 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PFB08_RS07055 | 1393781..1393950 | + | 170 | Protein_1376 | hypothetical protein | - |
| PFB08_RS07060 | 1394096..1394842 | + | 747 | WP_000789015.1 | ATP-binding protein | - |
| PFB08_RS07065 | 1394857..1395279 | + | 423 | WP_001118168.1 | DUF977 family protein | - |
| PFB08_RS07070 | 1395337..1395693 | + | 357 | WP_005048249.1 | hypothetical protein | - |
| PFB08_RS07075 | 1395786..1396004 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
| PFB08_RS07080 | 1396006..1396371 | + | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
| PFB08_RS07085 | 1396368..1397033 | + | 666 | WP_000208062.1 | hypothetical protein | - |
| PFB08_RS07090 | 1397033..1397398 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| - | 1397783..1397841 | - | 59 | - | - | Antitoxin |
| PFB08_RS07095 | 1397853..1398008 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| PFB08_RS07105 | 1399345..1399944 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
| PFB08_RS07110 | 1399944..1400234 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| PFB08_RS07115 | 1400231..1400785 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
| PFB08_RS07120 | 1400938..1401111 | + | 174 | WP_000504450.1 | hypothetical protein | - |
| PFB08_RS07125 | 1401173..1402329 | + | 1157 | WP_094105050.1 | IS3-like element IS600 family transposase | - |
| PFB08_RS07130 | 1402357..1402725 | + | 369 | WP_011069357.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 1385770..1444799 | 59029 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T278949 WP_000813254.1 NZ_CP123365:1397853-1398008 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT278949 NZ_CP123365:c1397841-1397783 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|