Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1266049..1266270 Replicon chromosome
Accession NZ_CP123365
Organism Shigella flexneri strain MMGSG_23

Toxin (Protein)


Gene name ldrD Uniprot ID A0A4P7TT65
Locus tag PFB08_RS06395 Protein ID WP_000170961.1
Coordinates 1266049..1266156 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1266204..1266270 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PFB08_RS06370 1261893..1262975 + 1083 WP_000804726.1 peptide chain release factor 1 -
PFB08_RS06375 1262975..1263808 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
PFB08_RS06380 1263805..1264197 + 393 WP_000200378.1 invasion regulator SirB2 -
PFB08_RS06385 1264201..1265010 + 810 WP_001257042.1 invasion regulator SirB1 -
PFB08_RS06390 1265046..1265900 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
PFB08_RS06395 1266049..1266156 - 108 WP_000170961.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1266204..1266270 + 67 - - Antitoxin
PFB08_RS06400 1266562..1267662 - 1101 WP_000063614.1 sodium-potassium/proton antiporter ChaA -
PFB08_RS06405 1267931..1268161 + 231 WP_001146444.1 putative cation transport regulator ChaB -
PFB08_RS06410 1268319..1269014 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
PFB08_RS06415 1269058..1269411 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
PFB08_RS06420 1269596..1270990 + 1395 WP_000086222.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T278945 WP_000170961.1 NZ_CP123365:c1266156-1266049 [Shigella flexneri]
MTLAQFAMTFWHDLAAPILAGIIAAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT278945 NZ_CP123365:1266204-1266270 [Shigella flexneri]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TT65

Antitoxin

Download structure file

References