Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 416621..417239 | Replicon | chromosome |
| Accession | NZ_CP123365 | ||
| Organism | Shigella flexneri strain MMGSG_23 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | PFB08_RS02050 | Protein ID | WP_001291435.1 |
| Coordinates | 416621..416839 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | Q0T7C3 |
| Locus tag | PFB08_RS02055 | Protein ID | WP_000344797.1 |
| Coordinates | 416865..417239 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PFB08_RS02020 (412513) | 412513..412824 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| PFB08_RS02030 (413203) | 413203..413556 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| PFB08_RS02035 (413598) | 413598..415148 | - | 1551 | WP_005098218.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| PFB08_RS02040 (415312) | 415312..415782 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| PFB08_RS02045 (415898) | 415898..416449 | - | 552 | Protein_398 | maltose O-acetyltransferase | - |
| PFB08_RS02050 (416621) | 416621..416839 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| PFB08_RS02055 (416865) | 416865..417239 | - | 375 | WP_000344797.1 | Hha toxicity modulator TomB | Antitoxin |
| PFB08_RS02060 (417785) | 417785..420934 | - | 3150 | WP_001132518.1 | efflux RND transporter permease AcrB | - |
| PFB08_RS02065 (420957) | 420957..422150 | - | 1194 | WP_011069267.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 411155..412483 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278944 WP_001291435.1 NZ_CP123365:c416839-416621 [Shigella flexneri]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14513.38 Da Isoelectric Point: 4.9091
>AT278944 WP_000344797.1 NZ_CP123365:c417239-416865 [Shigella flexneri]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPD8 |