Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 379439..380283 | Replicon | chromosome |
Accession | NZ_CP123365 | ||
Organism | Shigella flexneri strain MMGSG_23 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | - |
Locus tag | PFB08_RS01855 | Protein ID | WP_014532172.1 |
Coordinates | 379439..379900 (-) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A5H0K0 |
Locus tag | PFB08_RS01860 | Protein ID | WP_005053053.1 |
Coordinates | 379972..380283 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PFB08_RS01840 (374607) | 374607..376337 | - | 1731 | WP_000645013.1 | hypothetical protein | - |
PFB08_RS01845 (376390) | 376390..378543 | - | 2154 | WP_005060811.1 | SEL1-like repeat protein | - |
PFB08_RS01850 (378694) | 378694..379391 | + | 698 | WP_223368647.1 | IS1 family transposase | - |
PFB08_RS01855 (379439) | 379439..379900 | - | 462 | WP_014532172.1 | GNAT family N-acetyltransferase | Toxin |
PFB08_RS01860 (379972) | 379972..380283 | - | 312 | WP_005053053.1 | DUF1778 domain-containing protein | Antitoxin |
PFB08_RS01865 (380467) | 380467..381357 | - | 891 | WP_000971346.1 | heme o synthase | - |
PFB08_RS01870 (381369) | 381369..381698 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
PFB08_RS01875 (381698) | 381698..382312 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
PFB08_RS01880 (382302) | 382302..384293 | - | 1992 | Protein_366 | cytochrome o ubiquinol oxidase subunit I | - |
PFB08_RS01885 (384315) | 384315..384812 | - | 498 | Protein_367 | COX aromatic rich motif-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 378888..379391 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 16623.52 Da Isoelectric Point: 9.9538
>T278943 WP_014532172.1 NZ_CP123365:c379900-379439 [Shigella flexneri]
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|