Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 299410..300104 | Replicon | chromosome |
| Accession | NZ_CP123365 | ||
| Organism | Shigella flexneri strain MMGSG_23 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | PFB08_RS01455 | Protein ID | WP_001263491.1 |
| Coordinates | 299706..300104 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | Q0T7Q4 |
| Locus tag | PFB08_RS01450 | Protein ID | WP_000554759.1 |
| Coordinates | 299410..299703 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PFB08_RS01430 (295049) | 295049..295546 | + | 498 | WP_000006251.1 | REP-associated tyrosine transposase RayT | - |
| PFB08_RS01435 (295763) | 295763..297475 | - | 1713 | Protein_278 | flagellar biosynthesis protein FlhA | - |
| PFB08_RS01440 (297447) | 297447..298232 | + | 786 | WP_000207560.1 | putative lateral flagellar export/assembly protein LafU | - |
| PFB08_RS01445 (298303) | 298303..299358 | + | 1056 | WP_001226172.1 | DNA polymerase IV | - |
| PFB08_RS01450 (299410) | 299410..299703 | + | 294 | WP_000554759.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| PFB08_RS01455 (299706) | 299706..300104 | + | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| PFB08_RS01460 (300114) | 300114..300566 | + | 453 | WP_001059860.1 | GNAT family N-acetyltransferase | - |
| PFB08_RS01465 (300812) | 300812..301855 | + | 1044 | WP_005053205.1 | RNA ligase RtcB family protein | - |
| PFB08_RS01470 (301917) | 301917..302531 | + | 615 | Protein_285 | peptide chain release factor H | - |
| PFB08_RS01475 (302588) | 302588..304045 | - | 1458 | WP_001293030.1 | cytosol nonspecific dipeptidase | - |
| PFB08_RS01480 (304307) | 304307..304765 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | gtrA / gtrB / gtrII | 298303..339701 | 41398 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T278942 WP_001263491.1 NZ_CP123365:299706-300104 [Shigella flexneri]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TR46 |