Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 271347..271983 | Replicon | chromosome |
Accession | NZ_CP123352 | ||
Organism | Agrobacterium pusense strain GV2 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | QE155_RS14470 | Protein ID | WP_280170931.1 |
Coordinates | 271702..271983 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | QE155_RS14465 | Protein ID | WP_004444714.1 |
Coordinates | 271347..271646 (-) | Length | 100 a.a. |
Genomic Context
Location: 270455..271327 (873 bp)
Type: Others
Protein ID: WP_280170930.1
Type: Others
Protein ID: WP_280170930.1
Location: 266535..267263 (729 bp)
Type: Others
Protein ID: WP_280170927.1
Type: Others
Protein ID: WP_280170927.1
Location: 267260..268168 (909 bp)
Type: Others
Protein ID: WP_035208323.1
Type: Others
Protein ID: WP_035208323.1
Location: 268165..269037 (873 bp)
Type: Others
Protein ID: WP_280170928.1
Type: Others
Protein ID: WP_280170928.1
Location: 269108..270322 (1215 bp)
Type: Others
Protein ID: WP_280170929.1
Type: Others
Protein ID: WP_280170929.1
Location: 271347..271646 (300 bp)
Type: Antitoxin
Protein ID: WP_004444714.1
Type: Antitoxin
Protein ID: WP_004444714.1
Location: 271702..271983 (282 bp)
Type: Toxin
Protein ID: WP_280170931.1
Type: Toxin
Protein ID: WP_280170931.1
Location: 272061..272867 (807 bp)
Type: Others
Protein ID: WP_280170932.1
Type: Others
Protein ID: WP_280170932.1
Location: 272864..273898 (1035 bp)
Type: Others
Protein ID: WP_280170933.1
Type: Others
Protein ID: WP_280170933.1
Location: 273901..274944 (1044 bp)
Type: Others
Protein ID: WP_280170934.1
Type: Others
Protein ID: WP_280170934.1
Location: 274941..275948 (1008 bp)
Type: Others
Protein ID: WP_280170935.1
Type: Others
Protein ID: WP_280170935.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE155_RS14440 | 266535..267263 | - | 729 | WP_280170927.1 | ABC transporter ATP-binding protein | - |
QE155_RS14445 | 267260..268168 | - | 909 | WP_035208323.1 | branched-chain amino acid ABC transporter permease | - |
QE155_RS14450 | 268165..269037 | - | 873 | WP_280170928.1 | branched-chain amino acid ABC transporter permease | - |
QE155_RS14455 | 269108..270322 | - | 1215 | WP_280170929.1 | amino acid ABC transporter substrate-binding protein | - |
QE155_RS14460 | 270455..271327 | + | 873 | WP_280170930.1 | helix-turn-helix transcriptional regulator | - |
QE155_RS14465 | 271347..271646 | - | 300 | WP_004444714.1 | HigA family addiction module antitoxin | Antitoxin |
QE155_RS14470 | 271702..271983 | - | 282 | WP_280170931.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QE155_RS14475 | 272061..272867 | - | 807 | WP_280170932.1 | ABC transporter ATP-binding protein | - |
QE155_RS14480 | 272864..273898 | - | 1035 | WP_280170933.1 | iron chelate uptake ABC transporter family permease subunit | - |
QE155_RS14485 | 273901..274944 | - | 1044 | WP_280170934.1 | iron ABC transporter permease | - |
QE155_RS14490 | 274941..275948 | - | 1008 | WP_280170935.1 | iron-siderophore ABC transporter substrate-binding protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10637.07 Da Isoelectric Point: 9.0298
>T278938 WP_280170931.1 NZ_CP123352:c271983-271702 [Agrobacterium pusense]
MIRSFKNKLTASIDDGSVKKGFPSDMLRRAQQLLTILDAANTVEDLRSPPGNRLEKLSGDREGQYSIRINKQWRICFVWT
QAGPENVEITDYH
MIRSFKNKLTASIDDGSVKKGFPSDMLRRAQQLLTILDAANTVEDLRSPPGNRLEKLSGDREGQYSIRINKQWRICFVWT
QAGPENVEITDYH
Download Length: 282 bp