Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4519295..4520049 | Replicon | chromosome |
| Accession | NZ_CP123282 | ||
| Organism | Salmonella sp. SA14318 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | QEN32_RS21505 | Protein ID | WP_000558166.1 |
| Coordinates | 4519295..4519606 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QEN32_RS21510 | Protein ID | WP_001259011.1 |
| Coordinates | 4519603..4520049 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN32_RS21475 (4514953) | 4514953..4515855 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| QEN32_RS21480 (4515852) | 4515852..4516487 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QEN32_RS21485 (4516484) | 4516484..4517413 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| QEN32_RS21490 (4517460) | 4517460..4517750 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| QEN32_RS21495 (4517751) | 4517751..4518062 | - | 312 | WP_001159632.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| QEN32_RS21500 (4518280) | 4518280..4519209 | + | 930 | WP_265322369.1 | alpha/beta hydrolase | - |
| QEN32_RS21505 (4519295) | 4519295..4519606 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QEN32_RS21510 (4519603) | 4519603..4520049 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| QEN32_RS21515 (4520064) | 4520064..4521005 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| QEN32_RS21520 (4521050) | 4521050..4521487 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| QEN32_RS21525 (4521484) | 4521484..4522356 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| QEN32_RS21530 (4522350) | 4522350..4522949 | - | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| QEN32_RS21535 (4523140) | 4523140..4523943 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| QEN32_RS21540 (4523977) | 4523977..4524873 | - | 897 | WP_114051161.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T278913 WP_000558166.1 NZ_CP123282:4519295-4519606 [Salmonella sp. SA14318]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT278913 WP_001259011.1 NZ_CP123282:4519603-4520049 [Salmonella sp. SA14318]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|