Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 3592791..3593329 | Replicon | chromosome |
Accession | NZ_CP123280 | ||
Organism | Salmonella sp. SA17155 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | M7RHM1 |
Locus tag | QEN30_RS17840 | Protein ID | WP_001526148.1 |
Coordinates | 3593054..3593329 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | M7RMV7 |
Locus tag | QEN30_RS17835 | Protein ID | WP_000729713.1 |
Coordinates | 3592791..3593051 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN30_RS17815 (3588344) | 3588344..3589897 | + | 1554 | WP_000013007.1 | TROVE domain-containing protein | - |
QEN30_RS17820 (3589906) | 3589906..3590097 | + | 192 | Protein_3470 | TROVE domain-containing protein | - |
QEN30_RS17825 (3590445) | 3590445..3591659 | + | 1215 | WP_001105521.1 | RNA-splicing ligase RtcB | - |
QEN30_RS17830 (3591663) | 3591663..3592682 | + | 1020 | WP_000101027.1 | RNA 3'-terminal phosphate cyclase | - |
QEN30_RS17835 (3592791) | 3592791..3593051 | + | 261 | WP_000729713.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QEN30_RS17840 (3593054) | 3593054..3593329 | + | 276 | WP_001526148.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
QEN30_RS17845 (3593417) | 3593417..3596122 | - | 2706 | WP_000907029.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10739.34 Da Isoelectric Point: 8.8652
>T278892 WP_001526148.1 NZ_CP123280:3593054-3593329 [Salmonella sp. SA17155]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SM83 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4D6P2L2 |