Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3032803..3033557 | Replicon | chromosome |
| Accession | NZ_CP123280 | ||
| Organism | Salmonella sp. SA17155 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | QEN30_RS15225 | Protein ID | WP_000558166.1 |
| Coordinates | 3032803..3033114 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QEN30_RS15230 | Protein ID | WP_001259011.1 |
| Coordinates | 3033111..3033557 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN30_RS15195 (3028461) | 3028461..3029363 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| QEN30_RS15200 (3029360) | 3029360..3029995 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QEN30_RS15205 (3029992) | 3029992..3030921 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| QEN30_RS15210 (3030968) | 3030968..3031258 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| QEN30_RS15215 (3031259) | 3031259..3031570 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| QEN30_RS15220 (3031788) | 3031788..3032717 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| QEN30_RS15225 (3032803) | 3032803..3033114 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QEN30_RS15230 (3033111) | 3033111..3033557 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| QEN30_RS15235 (3033572) | 3033572..3034513 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| QEN30_RS15240 (3034558) | 3034558..3034995 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| QEN30_RS15245 (3034992) | 3034992..3035864 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| QEN30_RS15250 (3035858) | 3035858..3036457 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| QEN30_RS15255 (3036648) | 3036648..3037451 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| QEN30_RS15260 (3037485) | 3037485..3038381 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T278889 WP_000558166.1 NZ_CP123280:3032803-3033114 [Salmonella sp. SA17155]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT278889 WP_001259011.1 NZ_CP123280:3033111-3033557 [Salmonella sp. SA17155]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|