Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 345070..345295 | Replicon | chromosome |
Accession | NZ_CP123280 | ||
Organism | Salmonella sp. SA17155 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | QEN30_RS01980 | Protein ID | WP_000813254.1 |
Coordinates | 345140..345295 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 345070..345128 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN30_RS01950 | 340508..341254 | + | 747 | WP_052929112.1 | ATP-binding protein | - |
QEN30_RS01955 | 341277..342038 | + | 762 | WP_139707682.1 | DUF1627 domain-containing protein | - |
QEN30_RS01960 | 342054..342476 | + | 423 | WP_050306692.1 | DUF977 family protein | - |
QEN30_RS01965 | 342473..342673 | + | 201 | WP_042973267.1 | hypothetical protein | - |
QEN30_RS01970 | 342947..343525 | + | 579 | WP_001204666.1 | sce7726 family protein | - |
QEN30_RS01975 | 343485..344582 | - | 1098 | WP_042973270.1 | beta family protein | - |
- | 345070..345128 | - | 59 | - | - | Antitoxin |
QEN30_RS01980 | 345140..345295 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
QEN30_RS01985 | 345571..345783 | + | 213 | WP_052929182.1 | hypothetical protein | - |
QEN30_RS01990 | 345855..346454 | + | 600 | WP_052929183.1 | DUF1367 family protein | - |
QEN30_RS01995 | 346454..346744 | + | 291 | WP_001533370.1 | DUF1364 domain-containing protein | - |
QEN30_RS02000 | 346741..347283 | + | 543 | WP_000640144.1 | DUF1133 family protein | - |
QEN30_RS02005 | 347767..348102 | + | 336 | WP_001533367.1 | phage holin, lambda family | - |
QEN30_RS02010 | 348106..348582 | + | 477 | WP_001194114.1 | glycoside hydrolase family protein | - |
QEN30_RS02015 | 348566..348958 | + | 393 | WP_042043867.1 | DUF2570 domain-containing protein | - |
QEN30_RS02020 | 348843..349121 | + | 279 | WP_173671027.1 | hypothetical protein | - |
QEN30_RS02025 | 349102..349287 | + | 186 | WP_000113285.1 | hypothetical protein | - |
QEN30_RS02030 | 349420..349968 | - | 549 | WP_000762846.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sopE2 | 325009..405757 | 80748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T278880 WP_000813254.1 NZ_CP123280:345140-345295 [Salmonella sp. SA17155]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T278880 NZ_CP123280:345140-345295 [Salmonella sp. SA17155]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCGCTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCGCTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT278880 NZ_CP123280:c345128-345070 [Salmonella sp. SA17155]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|