Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralR-IsrA/- |
Location | 332379..332748 | Replicon | chromosome |
Accession | NZ_CP123280 | ||
Organism | Salmonella sp. SA17155 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | A0A891STD1 |
Locus tag | QEN30_RS01890 | Protein ID | WP_042853000.1 |
Coordinates | 332554..332748 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | IsrA | ||
Locus tag | - | ||
Coordinates | 332379..332555 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN30_RS01850 | 327817..328473 | - | 657 | WP_000100258.1 | carbon-nitrogen hydrolase family protein | - |
QEN30_RS01855 | 328581..328811 | - | 231 | WP_000856224.1 | DNA polymerase III subunit theta | - |
QEN30_RS01860 | 328949..329323 | + | 375 | WP_000168393.1 | CopC domain-containing protein YobA | - |
QEN30_RS01865 | 329324..330199 | + | 876 | WP_000979702.1 | copper homeostasis membrane protein CopD | - |
QEN30_RS01870 | 330216..330569 | + | 354 | WP_000722368.1 | YebY family protein | - |
QEN30_RS01875 | 330943..332019 | - | 1077 | WP_001189085.1 | phage integrase Arm DNA-binding domain-containing protein | - |
QEN30_RS01880 | 331985..332266 | - | 282 | WP_023234152.1 | excisionase | - |
QEN30_RS01885 | 332373..332561 | - | 189 | WP_052929118.1 | DUF1187 family protein | - |
- | 332379..332555 | + | 177 | NuclAT_0 | - | Antitoxin |
- | 332379..332555 | + | 177 | NuclAT_0 | - | Antitoxin |
- | 332379..332555 | + | 177 | NuclAT_0 | - | Antitoxin |
- | 332379..332555 | + | 177 | NuclAT_0 | - | Antitoxin |
QEN30_RS01890 | 332554..332748 | - | 195 | WP_042853000.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
QEN30_RS01895 | 332805..333614 | - | 810 | WP_052929117.1 | recombination protein RecT | - |
QEN30_RS01900 | 333607..336282 | - | 2676 | WP_052929116.1 | exodeoxyribonuclease VIII | - |
QEN30_RS01905 | 336383..336658 | - | 276 | WP_080312066.1 | hypothetical protein | - |
QEN30_RS01910 | 336733..336903 | - | 171 | WP_001359121.1 | YdaE family protein | - |
QEN30_RS01915 | 336903..337124 | - | 222 | WP_000560226.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sopE2 | 325009..405757 | 80748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7019.87 Da Isoelectric Point: 8.6419
>T278877 WP_042853000.1 NZ_CP123280:c332748-332554 [Salmonella sp. SA17155]
MRYDDVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDDVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 177 bp
>AT278877 NZ_CP123280:332379-332555 [Salmonella sp. SA17155]
GGACAGAAGTTTCTCGCAATTAAAATTTATCAGCTTTACTTTCTGCTCTCTGGACACGCCTGCTTCTTTTTTCCCTGAGA
GCATTTTTTCGCATTCTGATTTCGTTAATTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCTTTTTCA
ATAGTGGCAGTTATTTT
GGACAGAAGTTTCTCGCAATTAAAATTTATCAGCTTTACTTTCTGCTCTCTGGACACGCCTGCTTCTTTTTTCCCTGAGA
GCATTTTTTCGCATTCTGATTTCGTTAATTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCTTTTTCA
ATAGTGGCAGTTATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|