Detailed information of TA system TA278871

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 134337..134763
• Replicon: plasmid pYZLc23-1_159k
• Accession: NZ_CP123267
• Organism: Escherichia coli strain YZLc23-1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N4686_RS24410
• Protein ID: WP_001372321.1
• Coordinates: 134337..134462 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	134539..134763 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N4686_RS24370 (129711)	129711..130400	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
N4686_RS24375 (130587)	130587..130970	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N4686_RS24380 (131303)	131303..131893	+	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
N4686_RS24385 (132190)	132190..133011	-	822	WP_001234426.1	DUF932 domain-containing protein	-
N4686_RS24390 (133129)	133129..133416	-	288	WP_000107535.1	hypothetical protein	-
N4686_RS24395 (133441)	133441..133647	-	207	WP_000547968.1	hypothetical protein	-
N4686_RS24400 (133717)	133717..133889	+	173	Protein_147	hypothetical protein	-
N4686_RS24405 (133887)	133887..134117	-	231	WP_262930742.1	hypothetical protein	-
N4686_RS24410 (134337)	134337..134462	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N4686_RS24415 (134404)	134404..134553	-	150	Protein_150	plasmid maintenance protein Mok	-
- (134539)	134539..134763	-	225	NuclAT_0	-	Antitoxin
- (134539)	134539..134763	-	225	NuclAT_0	-	Antitoxin
- (134539)	134539..134763	-	225	NuclAT_0	-	Antitoxin
- (134539)	134539..134763	-	225	NuclAT_0	-	Antitoxin
N4686_RS24420 (134575)	134575..134763	+	189	WP_001299721.1	hypothetical protein	-
N4686_RS24425 (134732)	134732..135494	-	763	Protein_152	plasmid SOS inhibition protein A	-
N4686_RS24430 (135491)	135491..135925	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
N4686_RS24435 (135980)	135980..136177	-	198	Protein_154	hypothetical protein	-
N4686_RS24440 (136205)	136205..136438	-	234	WP_000005987.1	DUF905 family protein	-
N4686_RS24445 (136506)	136506..137045	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
N4686_RS24450 (137071)	137071..137277	-	207	WP_000275856.1	hypothetical protein	-
N4686_RS24455 (137347)	137347..137427	+	81	Protein_158	hypothetical protein	-
N4686_RS24460 (137610)	137610..137779	-	170	Protein_159	hypothetical protein	-
N4686_RS24465 (138373)	138373..139344	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / rmtB / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / aph(3')-Ia / fosA3 / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..159725	159725

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T278871 WP_001372321.1 NZ_CP123267:c134462-134337 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT278871 NZ_CP123267:c134763-134539 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin