Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 96008..96262 | Replicon | plasmid pYZLc23-1_159k |
| Accession | NZ_CP123267 | ||
| Organism | Escherichia coli strain YZLc23-1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | N4686_RS24175 | Protein ID | WP_001312851.1 |
| Coordinates | 96008..96157 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 96201..96262 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4686_RS24130 (91560) | 91560..91961 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| N4686_RS24135 (91894) | 91894..92151 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| N4686_RS24140 (92244) | 92244..92897 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| N4686_RS24145 (92995) | 92995..93135 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| N4686_RS24150 (93836) | 93836..94693 | - | 858 | WP_159139076.1 | incFII family plasmid replication initiator RepA | - |
| N4686_RS24155 (94686) | 94686..95168 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| N4686_RS24160 (95161) | 95161..95208 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| N4686_RS24165 (95199) | 95199..95450 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| N4686_RS24170 (95467) | 95467..95724 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| N4686_RS24175 (96008) | 96008..96157 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (96201) | 96201..96262 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (96201) | 96201..96262 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (96201) | 96201..96262 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (96201) | 96201..96262 | + | 62 | NuclAT_1 | - | Antitoxin |
| N4686_RS24180 (96518) | 96518..96592 | - | 75 | Protein_103 | endonuclease | - |
| N4686_RS24185 (96838) | 96838..97050 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| N4686_RS24190 (97186) | 97186..97746 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| N4686_RS24195 (97849) | 97849..98709 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| N4686_RS24200 (98768) | 98768..99514 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / rmtB / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / aph(3')-Ia / fosA3 / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..159725 | 159725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T278866 WP_001312851.1 NZ_CP123267:c96157-96008 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT278866 NZ_CP123267:96201-96262 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|