Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4698677..4699279 | Replicon | chromosome |
Accession | NZ_CP123266 | ||
Organism | Escherichia coli strain YZLc23-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | N4686_RS22680 | Protein ID | WP_000897305.1 |
Coordinates | 4698968..4699279 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N4686_RS22675 | Protein ID | WP_000356397.1 |
Coordinates | 4698677..4698967 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4686_RS22650 (4694603) | 4694603..4695505 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
N4686_RS22655 (4695502) | 4695502..4696137 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
N4686_RS22660 (4696134) | 4696134..4697063 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
N4686_RS22665 (4697393) | 4697393..4697635 | - | 243 | WP_001086388.1 | protein YiiF | - |
N4686_RS22670 (4697854) | 4697854..4698072 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
N4686_RS22675 (4698677) | 4698677..4698967 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N4686_RS22680 (4698968) | 4698968..4699279 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
N4686_RS22685 (4699508) | 4699508..4700416 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
N4686_RS22690 (4700480) | 4700480..4701421 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
N4686_RS22695 (4701466) | 4701466..4701903 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
N4686_RS22700 (4701900) | 4701900..4702772 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N4686_RS22705 (4702766) | 4702766..4703365 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
N4686_RS22710 (4703464) | 4703464..4704249 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T278864 WP_000897305.1 NZ_CP123266:c4699279-4698968 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|