Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4673951..4674553 | Replicon | chromosome |
Accession | NZ_CP123260 | ||
Organism | Escherichia coli strain YZLc4-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | N4697_RS22505 | Protein ID | WP_000897305.1 |
Coordinates | 4674242..4674553 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N4697_RS22500 | Protein ID | WP_000356397.1 |
Coordinates | 4673951..4674241 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4697_RS22475 (4669383) | 4669383..4670018 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
N4697_RS22480 (4670015) | 4670015..4670944 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
N4697_RS22485 (4671457) | 4671457..4672437 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
N4697_RS22490 (4672667) | 4672667..4672909 | - | 243 | WP_001086388.1 | protein YiiF | - |
N4697_RS22495 (4673128) | 4673128..4673346 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
N4697_RS22500 (4673951) | 4673951..4674241 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N4697_RS22505 (4674242) | 4674242..4674553 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
N4697_RS22510 (4674782) | 4674782..4675690 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
N4697_RS22515 (4675754) | 4675754..4676695 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
N4697_RS22520 (4676740) | 4676740..4677177 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
N4697_RS22525 (4677174) | 4677174..4678046 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N4697_RS22530 (4678040) | 4678040..4678639 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4671457..4672437 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T278837 WP_000897305.1 NZ_CP123260:c4674553-4674242 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|