Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1092712..1093439 | Replicon | chromosome |
| Accession | NZ_CP123260 | ||
| Organism | Escherichia coli strain YZLc4-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q3YYE6 |
| Locus tag | N4697_RS05285 | Protein ID | WP_000547563.1 |
| Coordinates | 1092712..1093023 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4697_RS05290 | Protein ID | WP_000126294.1 |
| Coordinates | 1093020..1093439 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4697_RS05255 (1087855) | 1087855..1089564 | + | 1710 | WP_063625439.1 | formate hydrogenlyase subunit HycE | - |
| N4697_RS05260 (1089574) | 1089574..1090116 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| N4697_RS05265 (1090116) | 1090116..1090883 | + | 768 | WP_000067401.1 | formate hydrogenlyase subunit HycG | - |
| N4697_RS05270 (1090880) | 1090880..1091290 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| N4697_RS05275 (1091283) | 1091283..1091753 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| N4697_RS05280 (1091796) | 1091796..1092539 | + | 744 | WP_058101263.1 | hypothetical protein | - |
| N4697_RS05285 (1092712) | 1092712..1093023 | + | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N4697_RS05290 (1093020) | 1093020..1093439 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N4697_RS05295 (1093553) | 1093553..1094977 | - | 1425 | WP_000110365.1 | 6-phospho-beta-glucosidase AscB | - |
| N4697_RS05300 (1094986) | 1094986..1096443 | - | 1458 | WP_001107882.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| N4697_RS05305 (1096703) | 1096703..1097713 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
| N4697_RS05310 (1097862) | 1097862..1098389 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T278823 WP_000547563.1 NZ_CP123260:1092712-1093023 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT278823 WP_000126294.1 NZ_CP123260:1093020-1093439 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|