Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 39544..39813 | Replicon | plasmid pYZMc17-1_NDM-5_80K |
| Accession | NZ_CP123257 | ||
| Organism | Escherichia coli strain YZMc17-1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | N4680_RS24295 | Protein ID | WP_001372321.1 |
| Coordinates | 39688..39813 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 39544..39609 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4680_RS24260 | 35254..35781 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| N4680_RS24265 | 35839..36072 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| N4680_RS24270 | 36133..38156 | + | 2024 | Protein_48 | ParB/RepB/Spo0J family partition protein | - |
| N4680_RS24275 | 38225..38659 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| N4680_RS24280 | 38656..39418 | + | 763 | Protein_50 | plasmid SOS inhibition protein A | - |
| - | 39387..39611 | + | 225 | NuclAT_0 | - | - |
| - | 39387..39611 | + | 225 | NuclAT_0 | - | - |
| - | 39387..39611 | + | 225 | NuclAT_0 | - | - |
| - | 39387..39611 | + | 225 | NuclAT_0 | - | - |
| N4680_RS24285 | 39396..39575 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 39544..39609 | - | 66 | - | - | Antitoxin |
| N4680_RS24290 | 39597..39746 | + | 150 | Protein_52 | plasmid maintenance protein Mok | - |
| N4680_RS24295 | 39688..39813 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| N4680_RS24300 | 40132..40428 | - | 297 | Protein_54 | hypothetical protein | - |
| N4680_RS24305 | 40728..41024 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| N4680_RS24310 | 41135..41956 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| N4680_RS24315 | 42253..42900 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| N4680_RS24320 | 43177..43560 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| N4680_RS24325 | 43751..44437 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| N4680_RS24330 | 44531..44758 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaNDM-5 / blaTEM-1B / rmtB | - | 1..80091 | 80091 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T278815 WP_001372321.1 NZ_CP123257:39688-39813 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT278815 NZ_CP123257:c39609-39544 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|