Detailed information of TA system TA278815

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 39544..39813
• Replicon: plasmid pYZMc17-1_NDM-5_80K
• Accession: NZ_CP123257
• Organism: Escherichia coli strain YZMc17-1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N4680_RS24295
• Protein ID: WP_001372321.1
• Coordinates: 39688..39813 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	39544..39609 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N4680_RS24260	35254..35781	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
N4680_RS24265	35839..36072	+	234	WP_000006003.1	DUF905 family protein	-
N4680_RS24270	36133..38156	+	2024	Protein_48	ParB/RepB/Spo0J family partition protein	-
N4680_RS24275	38225..38659	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
N4680_RS24280	38656..39418	+	763	Protein_50	plasmid SOS inhibition protein A	-
-	39387..39611	+	225	NuclAT_0	-	-
-	39387..39611	+	225	NuclAT_0	-	-
-	39387..39611	+	225	NuclAT_0	-	-
-	39387..39611	+	225	NuclAT_0	-	-
N4680_RS24285	39396..39575	-	180	WP_001309233.1	hypothetical protein	-
-	39544..39609	-	66	-	-	Antitoxin
N4680_RS24290	39597..39746	+	150	Protein_52	plasmid maintenance protein Mok	-
N4680_RS24295	39688..39813	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N4680_RS24300	40132..40428	-	297	Protein_54	hypothetical protein	-
N4680_RS24305	40728..41024	+	297	WP_001272251.1	hypothetical protein	-
N4680_RS24310	41135..41956	+	822	WP_001234445.1	DUF932 domain-containing protein	-
N4680_RS24315	42253..42900	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
N4680_RS24320	43177..43560	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N4680_RS24325	43751..44437	+	687	WP_015059009.1	PAS domain-containing protein	-
N4680_RS24330	44531..44758	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaNDM-5 / blaTEM-1B / rmtB	-	1..80091	80091

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T278815 WP_001372321.1 NZ_CP123257:39688-39813 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT278815 NZ_CP123257:c39609-39544 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin