Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1119204..1119931 | Replicon | chromosome |
Accession | NZ_CP123255 | ||
Organism | Escherichia coli strain YZMc17-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A829L2T9 |
Locus tag | N4680_RS05490 | Protein ID | WP_001521139.1 |
Coordinates | 1119204..1119515 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N4680_RS05495 | Protein ID | WP_000126294.1 |
Coordinates | 1119512..1119931 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4680_RS05465 (1115139) | 1115139..1116848 | + | 1710 | WP_001521140.1 | formate hydrogenlyase subunit HycE | - |
N4680_RS05470 (1116858) | 1116858..1117400 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
N4680_RS05475 (1117400) | 1117400..1118167 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
N4680_RS05480 (1118164) | 1118164..1118574 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
N4680_RS05485 (1118567) | 1118567..1119037 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
N4680_RS05490 (1119204) | 1119204..1119515 | + | 312 | WP_001521139.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
N4680_RS05495 (1119512) | 1119512..1119931 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
N4680_RS05500 (1120010) | 1120010..1121434 | - | 1425 | WP_020234028.1 | 6-phospho-beta-glucosidase AscB | - |
N4680_RS05505 (1121443) | 1121443..1122900 | - | 1458 | WP_020234027.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
N4680_RS05510 (1123160) | 1123160..1124170 | + | 1011 | WP_015912547.1 | DNA-binding transcriptional regulator AscG | - |
N4680_RS05515 (1124319) | 1124319..1124846 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12493.23 Da Isoelectric Point: 9.4783
>T278800 WP_001521139.1 NZ_CP123255:1119204-1119515 [Escherichia coli]
MHIISKAPFEECARKYPNDALALYSLYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALYSLYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT278800 WP_000126294.1 NZ_CP123255:1119512-1119931 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|