Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 710256..710949 | Replicon | chromosome |
Accession | NZ_CP123255 | ||
Organism | Escherichia coli strain YZMc17-1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | N4680_RS03465 | Protein ID | WP_000415584.1 |
Coordinates | 710256..710552 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | N4680_RS03470 | Protein ID | WP_000650107.1 |
Coordinates | 710554..710949 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4680_RS03430 (705344) | 705344..705658 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
N4680_RS03435 (705689) | 705689..706270 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
N4680_RS03440 (706589) | 706589..706921 | + | 333 | WP_224684392.1 | DUF2645 family protein | - |
N4680_RS03445 (706967) | 706967..708316 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
N4680_RS03450 (708313) | 708313..708972 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
N4680_RS03455 (709124) | 709124..709516 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
N4680_RS03460 (709569) | 709569..710051 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
N4680_RS03465 (710256) | 710256..710552 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
N4680_RS03470 (710554) | 710554..710949 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
N4680_RS03475 (711082) | 711082..712689 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
N4680_RS03480 (712827) | 712827..715085 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T278796 WP_000415584.1 NZ_CP123255:710256-710552 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT278796 WP_000650107.1 NZ_CP123255:710554-710949 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|