Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 90282..90708 | Replicon | plasmid pYZMc3-1_115k |
| Accession | NZ_CP123246 | ||
| Organism | Escherichia coli strain YZMc3-1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | N4691_RS24555 | Protein ID | WP_001372321.1 |
| Coordinates | 90282..90407 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 90484..90708 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4691_RS24515 (85656) | 85656..86345 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| N4691_RS24520 (86532) | 86532..86915 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| N4691_RS24525 (87248) | 87248..87838 | + | 591 | WP_001376243.1 | transglycosylase SLT domain-containing protein | - |
| N4691_RS24530 (88135) | 88135..88956 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| N4691_RS24535 (89074) | 89074..89361 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| N4691_RS24540 (89386) | 89386..89592 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| N4691_RS24545 (89662) | 89662..89834 | + | 173 | Protein_95 | hypothetical protein | - |
| N4691_RS24550 (89832) | 89832..90062 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| N4691_RS24555 (90282) | 90282..90407 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| N4691_RS24560 (90349) | 90349..90498 | - | 150 | Protein_98 | plasmid maintenance protein Mok | - |
| - (90484) | 90484..90708 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (90484) | 90484..90708 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (90484) | 90484..90708 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (90484) | 90484..90708 | - | 225 | NuclAT_0 | - | Antitoxin |
| N4691_RS24565 (90520) | 90520..90708 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| N4691_RS24570 (90677) | 90677..91439 | - | 763 | Protein_100 | plasmid SOS inhibition protein A | - |
| N4691_RS24575 (91436) | 91436..91870 | - | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| N4691_RS24580 (91925) | 91925..92122 | - | 198 | Protein_102 | hypothetical protein | - |
| N4691_RS24585 (92150) | 92150..92383 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
| N4691_RS24590 (92451) | 92451..92990 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| N4691_RS24595 (93016) | 93016..93222 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| N4691_RS24600 (93292) | 93292..93372 | + | 81 | Protein_106 | hypothetical protein | - |
| N4691_RS24605 (93555) | 93555..93724 | - | 170 | Protein_107 | hypothetical protein | - |
| N4691_RS24610 (94318) | 94318..95289 | - | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..115670 | 115670 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T278781 WP_001372321.1 NZ_CP123246:c90407-90282 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT278781 NZ_CP123246:c90708-90484 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|