Detailed information of TA system TA278781

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 90282..90708
• Replicon: plasmid pYZMc3-1_115k
• Accession: NZ_CP123246
• Organism: Escherichia coli strain YZMc3-1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N4691_RS24555
• Protein ID: WP_001372321.1
• Coordinates: 90282..90407 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	90484..90708 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N4691_RS24515 (85656)	85656..86345	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
N4691_RS24520 (86532)	86532..86915	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N4691_RS24525 (87248)	87248..87838	+	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
N4691_RS24530 (88135)	88135..88956	-	822	WP_001234426.1	DUF932 domain-containing protein	-
N4691_RS24535 (89074)	89074..89361	-	288	WP_000107535.1	hypothetical protein	-
N4691_RS24540 (89386)	89386..89592	-	207	WP_000547968.1	hypothetical protein	-
N4691_RS24545 (89662)	89662..89834	+	173	Protein_95	hypothetical protein	-
N4691_RS24550 (89832)	89832..90062	-	231	WP_071586998.1	hypothetical protein	-
N4691_RS24555 (90282)	90282..90407	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N4691_RS24560 (90349)	90349..90498	-	150	Protein_98	plasmid maintenance protein Mok	-
- (90484)	90484..90708	-	225	NuclAT_0	-	Antitoxin
- (90484)	90484..90708	-	225	NuclAT_0	-	Antitoxin
- (90484)	90484..90708	-	225	NuclAT_0	-	Antitoxin
- (90484)	90484..90708	-	225	NuclAT_0	-	Antitoxin
N4691_RS24565 (90520)	90520..90708	+	189	WP_001299721.1	hypothetical protein	-
N4691_RS24570 (90677)	90677..91439	-	763	Protein_100	plasmid SOS inhibition protein A	-
N4691_RS24575 (91436)	91436..91870	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
N4691_RS24580 (91925)	91925..92122	-	198	Protein_102	hypothetical protein	-
N4691_RS24585 (92150)	92150..92383	-	234	WP_000005987.1	DUF905 family protein	-
N4691_RS24590 (92451)	92451..92990	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
N4691_RS24595 (93016)	93016..93222	-	207	WP_000275856.1	hypothetical protein	-
N4691_RS24600 (93292)	93292..93372	+	81	Protein_106	hypothetical protein	-
N4691_RS24605 (93555)	93555..93724	-	170	Protein_107	hypothetical protein	-
N4691_RS24610 (94318)	94318..95289	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-55 / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..115670	115670

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T278781 WP_001372321.1 NZ_CP123246:c90407-90282 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT278781 NZ_CP123246:c90708-90484 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin