Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 51331..51585 | Replicon | plasmid pYZMc3-1_115k |
| Accession | NZ_CP123246 | ||
| Organism | Escherichia coli strain YZMc3-1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | N4691_RS24310 | Protein ID | WP_001312851.1 |
| Coordinates | 51331..51480 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 51524..51585 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4691_RS24265 (46883) | 46883..47284 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| N4691_RS24270 (47217) | 47217..47474 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| N4691_RS24275 (47567) | 47567..48220 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| N4691_RS24280 (48318) | 48318..48458 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| N4691_RS24285 (49159) | 49159..50016 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| N4691_RS24290 (50009) | 50009..50491 | - | 483 | WP_241225813.1 | hypothetical protein | - |
| N4691_RS24295 (50484) | 50484..50531 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| N4691_RS24300 (50522) | 50522..50773 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| N4691_RS24305 (50790) | 50790..51047 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| N4691_RS24310 (51331) | 51331..51480 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (51524) | 51524..51585 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (51524) | 51524..51585 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (51524) | 51524..51585 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (51524) | 51524..51585 | + | 62 | NuclAT_1 | - | Antitoxin |
| N4691_RS24315 (51841) | 51841..51915 | - | 75 | Protein_49 | endonuclease | - |
| N4691_RS24320 (52161) | 52161..52373 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| N4691_RS24325 (52509) | 52509..53069 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| N4691_RS24330 (53172) | 53172..54032 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| N4691_RS24335 (54091) | 54091..54837 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| N4691_RS24340 (54857) | 54857..55207 | - | 351 | WP_284183077.1 | protein traI | - |
| N4691_RS24345 (55232) | 55232..55936 | + | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..115670 | 115670 | |
| - | flank | IS/Tn | - | - | 55232..55936 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T278776 WP_001312851.1 NZ_CP123246:c51480-51331 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT278776 NZ_CP123246:51524-51585 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|