Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4612294..4612896 | Replicon | chromosome |
| Accession | NZ_CP123244 | ||
| Organism | Escherichia coli strain YZMc3-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | N4691_RS21880 | Protein ID | WP_000897305.1 |
| Coordinates | 4612585..4612896 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4691_RS21875 | Protein ID | WP_000356397.1 |
| Coordinates | 4612294..4612584 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4691_RS21850 (4608238) | 4608238..4609140 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| N4691_RS21855 (4609137) | 4609137..4609772 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N4691_RS21860 (4609769) | 4609769..4610698 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| N4691_RS21865 (4611028) | 4611028..4611270 | - | 243 | WP_001087409.1 | protein YiiF | - |
| N4691_RS21870 (4611490) | 4611490..4611708 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| N4691_RS21875 (4612294) | 4612294..4612584 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| N4691_RS21880 (4612585) | 4612585..4612896 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| N4691_RS21885 (4613125) | 4613125..4614033 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| N4691_RS21890 (4614097) | 4614097..4615038 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N4691_RS21895 (4615083) | 4615083..4615520 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| N4691_RS21900 (4615517) | 4615517..4616389 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| N4691_RS21905 (4616383) | 4616383..4616982 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| N4691_RS21910 (4617081) | 4617081..4617866 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T278774 WP_000897305.1 NZ_CP123244:c4612896-4612585 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|