Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 635652..636451 | Replicon | chromosome |
| Accession | NZ_CP123244 | ||
| Organism | Escherichia coli strain YZMc3-1 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A161R7C1 |
| Locus tag | N4691_RS03060 | Protein ID | WP_000347278.1 |
| Coordinates | 635652..636116 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | N4691_RS03065 | Protein ID | WP_001307405.1 |
| Coordinates | 636116..636451 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4691_RS03030 (630653) | 630653..631087 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| N4691_RS03035 (631105) | 631105..631983 | - | 879 | WP_021557244.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N4691_RS03040 (631973) | 631973..632752 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N4691_RS03045 (632763) | 632763..633236 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N4691_RS03050 (633259) | 633259..634539 | - | 1281 | WP_021557243.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N4691_RS03055 (634788) | 634788..635597 | + | 810 | WP_000072174.1 | aga operon transcriptional regulator AgaR | - |
| N4691_RS03060 (635652) | 635652..636116 | - | 465 | WP_000347278.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N4691_RS03065 (636116) | 636116..636451 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N4691_RS03070 (636600) | 636600..638171 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
| N4691_RS03075 (638546) | 638546..639880 | + | 1335 | WP_000599633.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N4691_RS03080 (639896) | 639896..640666 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17866.28 Da Isoelectric Point: 9.6924
>T278759 WP_000347278.1 NZ_CP123244:c636116-635652 [Escherichia coli]
MDFPQRVNGWALYTHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYTHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A161R7C1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |