Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 135492..135918 | Replicon | plasmid pYZLc1-3_160k |
| Accession | NZ_CP123241 | ||
| Organism | Escherichia coli strain YZLc1-3 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | N4725_RS26000 | Protein ID | WP_001372321.1 |
| Coordinates | 135492..135617 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 135694..135918 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4725_RS25960 (130866) | 130866..131555 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| N4725_RS25965 (131742) | 131742..132125 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| N4725_RS25970 (132458) | 132458..133048 | + | 591 | WP_001376243.1 | transglycosylase SLT domain-containing protein | - |
| N4725_RS25975 (133345) | 133345..134166 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| N4725_RS25980 (134284) | 134284..134571 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| N4725_RS25985 (134596) | 134596..134802 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| N4725_RS25990 (134872) | 134872..135044 | + | 173 | Protein_151 | hypothetical protein | - |
| N4725_RS25995 (135042) | 135042..135272 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| N4725_RS26000 (135492) | 135492..135617 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| N4725_RS26005 (135559) | 135559..135708 | - | 150 | Protein_154 | plasmid maintenance protein Mok | - |
| - (135694) | 135694..135918 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (135694) | 135694..135918 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (135694) | 135694..135918 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (135694) | 135694..135918 | - | 225 | NuclAT_0 | - | Antitoxin |
| N4725_RS26010 (135730) | 135730..135918 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| N4725_RS26015 (135887) | 135887..136649 | - | 763 | Protein_156 | plasmid SOS inhibition protein A | - |
| N4725_RS26020 (136646) | 136646..137080 | - | 435 | WP_181726437.1 | conjugation system SOS inhibitor PsiB | - |
| N4725_RS26025 (137135) | 137135..137332 | - | 198 | Protein_158 | hypothetical protein | - |
| N4725_RS26030 (137360) | 137360..137593 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
| N4725_RS26035 (137661) | 137661..138200 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| N4725_RS26040 (138226) | 138226..138432 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| N4725_RS26045 (138502) | 138502..138582 | + | 81 | Protein_162 | hypothetical protein | - |
| N4725_RS26050 (138765) | 138765..138934 | - | 170 | Protein_163 | hypothetical protein | - |
| N4725_RS26055 (139571) | 139571..140542 | - | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / dfrA12 / aadA2 / qacE / mph(A) / aph(3')-Ia / aac(3)-IId / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..160923 | 160923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T278755 WP_001372321.1 NZ_CP123241:c135617-135492 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT278755 NZ_CP123241:c135918-135694 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|