Detailed information of TA system TA278755

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 135492..135918
• Replicon: plasmid pYZLc1-3_160k
• Accession: NZ_CP123241
• Organism: Escherichia coli strain YZLc1-3

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N4725_RS26000
• Protein ID: WP_001372321.1
• Coordinates: 135492..135617 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	135694..135918 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N4725_RS25960 (130866)	130866..131555	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
N4725_RS25965 (131742)	131742..132125	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N4725_RS25970 (132458)	132458..133048	+	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
N4725_RS25975 (133345)	133345..134166	-	822	WP_001234426.1	DUF932 domain-containing protein	-
N4725_RS25980 (134284)	134284..134571	-	288	WP_000107535.1	hypothetical protein	-
N4725_RS25985 (134596)	134596..134802	-	207	WP_000547968.1	hypothetical protein	-
N4725_RS25990 (134872)	134872..135044	+	173	Protein_151	hypothetical protein	-
N4725_RS25995 (135042)	135042..135272	-	231	WP_071586998.1	hypothetical protein	-
N4725_RS26000 (135492)	135492..135617	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N4725_RS26005 (135559)	135559..135708	-	150	Protein_154	plasmid maintenance protein Mok	-
- (135694)	135694..135918	-	225	NuclAT_0	-	Antitoxin
- (135694)	135694..135918	-	225	NuclAT_0	-	Antitoxin
- (135694)	135694..135918	-	225	NuclAT_0	-	Antitoxin
- (135694)	135694..135918	-	225	NuclAT_0	-	Antitoxin
N4725_RS26010 (135730)	135730..135918	+	189	WP_001299721.1	hypothetical protein	-
N4725_RS26015 (135887)	135887..136649	-	763	Protein_156	plasmid SOS inhibition protein A	-
N4725_RS26020 (136646)	136646..137080	-	435	WP_181726437.1	conjugation system SOS inhibitor PsiB	-
N4725_RS26025 (137135)	137135..137332	-	198	Protein_158	hypothetical protein	-
N4725_RS26030 (137360)	137360..137593	-	234	WP_000005987.1	DUF905 family protein	-
N4725_RS26035 (137661)	137661..138200	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
N4725_RS26040 (138226)	138226..138432	-	207	WP_000275856.1	hypothetical protein	-
N4725_RS26045 (138502)	138502..138582	+	81	Protein_162	hypothetical protein	-
N4725_RS26050 (138765)	138765..138934	-	170	Protein_163	hypothetical protein	-
N4725_RS26055 (139571)	139571..140542	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / dfrA12 / aadA2 / qacE / mph(A) / aph(3')-Ia / aac(3)-IId / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..160923	160923

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T278755 WP_001372321.1 NZ_CP123241:c135617-135492 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT278755 NZ_CP123241:c135918-135694 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin