Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 97163..97417 | Replicon | plasmid pYZLc1-3_160k |
| Accession | NZ_CP123241 | ||
| Organism | Escherichia coli strain YZLc1-3 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | N4725_RS25765 | Protein ID | WP_001312851.1 |
| Coordinates | 97163..97312 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 97356..97417 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4725_RS25740 (92247) | 92247..92387 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| N4725_RS25745 (93167) | 93167..96184 | - | 3018 | WP_004199413.1 | Tn3-like element IS3000 family transposase | - |
| N4725_RS25750 (96214) | 96214..96390 | - | 177 | WP_284180544.1 | RepA leader peptide Tap | - |
| N4725_RS25755 (96354) | 96354..96605 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| N4725_RS25760 (96622) | 96622..96879 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| N4725_RS25765 (97163) | 97163..97312 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (97356) | 97356..97417 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (97356) | 97356..97417 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (97356) | 97356..97417 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (97356) | 97356..97417 | + | 62 | NuclAT_1 | - | Antitoxin |
| N4725_RS25770 (97673) | 97673..97747 | - | 75 | Protein_107 | endonuclease | - |
| N4725_RS25775 (97993) | 97993..98205 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| N4725_RS25780 (98341) | 98341..98901 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| N4725_RS25785 (99004) | 99004..99864 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| N4725_RS25790 (99923) | 99923..100669 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / dfrA12 / aadA2 / qacE / mph(A) / aph(3')-Ia / aac(3)-IId / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..160923 | 160923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T278750 WP_001312851.1 NZ_CP123241:c97312-97163 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT278750 NZ_CP123241:97356-97417 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|