Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 97163..97417 Replicon plasmid pYZLc1-3_160k
Accession NZ_CP123241
Organism Escherichia coli strain YZLc1-3

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag N4725_RS25765 Protein ID WP_001312851.1
Coordinates 97163..97312 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 97356..97417 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4725_RS25740 (92247) 92247..92387 - 141 WP_001333237.1 hypothetical protein -
N4725_RS25745 (93167) 93167..96184 - 3018 WP_004199413.1 Tn3-like element IS3000 family transposase -
N4725_RS25750 (96214) 96214..96390 - 177 WP_284180544.1 RepA leader peptide Tap -
N4725_RS25755 (96354) 96354..96605 + 252 WP_223195197.1 replication protein RepA -
N4725_RS25760 (96622) 96622..96879 - 258 WP_000083845.1 replication regulatory protein RepA -
N4725_RS25765 (97163) 97163..97312 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (97356) 97356..97417 + 62 NuclAT_1 - Antitoxin
- (97356) 97356..97417 + 62 NuclAT_1 - Antitoxin
- (97356) 97356..97417 + 62 NuclAT_1 - Antitoxin
- (97356) 97356..97417 + 62 NuclAT_1 - Antitoxin
N4725_RS25770 (97673) 97673..97747 - 75 Protein_107 endonuclease -
N4725_RS25775 (97993) 97993..98205 - 213 WP_001299730.1 ANR family transcriptional regulator -
N4725_RS25780 (98341) 98341..98901 - 561 WP_000139315.1 fertility inhibition protein FinO -
N4725_RS25785 (99004) 99004..99864 - 861 WP_000704514.1 alpha/beta hydrolase -
N4725_RS25790 (99923) 99923..100669 - 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / dfrA12 / aadA2 / qacE / mph(A) / aph(3')-Ia / aac(3)-IId / sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..160923 160923


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T278750 WP_001312851.1 NZ_CP123241:c97312-97163 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT278750 NZ_CP123241:97356-97417 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References