Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5014743..5015345 | Replicon | chromosome |
| Accession | NZ_CP123240 | ||
| Organism | Escherichia coli strain YZLc1-3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | N4725_RS24275 | Protein ID | WP_000897305.1 |
| Coordinates | 5015034..5015345 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4725_RS24270 | Protein ID | WP_000356395.1 |
| Coordinates | 5014743..5015033 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4725_RS24235 (5010367) | 5010367..5011269 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| N4725_RS24240 (5011266) | 5011266..5011901 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N4725_RS24245 (5011898) | 5011898..5012827 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| N4725_RS24250 (5013009) | 5013009..5013251 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
| N4725_RS24255 (5013470) | 5013470..5013688 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| N4725_RS24260 (5014107) | 5014107..5014385 | - | 279 | WP_001315112.1 | hypothetical protein | - |
| N4725_RS24265 (5014437) | 5014437..5014658 | - | 222 | WP_106475282.1 | cobalt ABC transporter ATP-binding protein | - |
| N4725_RS24270 (5014743) | 5014743..5015033 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| N4725_RS24275 (5015034) | 5015034..5015345 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| N4725_RS24280 (5015574) | 5015574..5016482 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
| N4725_RS24285 (5016650) | 5016650..5017564 | - | 915 | WP_109553727.1 | transposase | - |
| N4725_RS24290 (5017577) | 5017577..5018464 | - | 888 | Protein_4749 | hypothetical protein | - |
| N4725_RS24295 (5018880) | 5018880..5019821 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N4725_RS24300 (5019866) | 5019866..5020303 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T278749 WP_000897305.1 NZ_CP123240:c5015345-5015034 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|