Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4024528..4025222 Replicon chromosome
Accession NZ_CP123240
Organism Escherichia coli strain YZLc1-3

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag N4725_RS19595 Protein ID WP_001263491.1
Coordinates 4024528..4024926 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag N4725_RS19600 Protein ID WP_000554755.1
Coordinates 4024929..4025222 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4020357) 4020357..4020437 - 81 NuclAT_9 - -
- (4020357) 4020357..4020437 - 81 NuclAT_9 - -
- (4020357) 4020357..4020437 - 81 NuclAT_9 - -
- (4020357) 4020357..4020437 - 81 NuclAT_9 - -
N4725_RS19565 (4019697) 4019697..4020941 - 1245 WP_000189541.1 esterase FrsA -
N4725_RS19570 (4021033) 4021033..4021491 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
N4725_RS19575 (4021752) 4021752..4023209 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
N4725_RS19580 (4023266) 4023266..4023618 - 353 Protein_3834 peptide chain release factor H -
N4725_RS19585 (4023614) 4023614..4023820 - 207 Protein_3835 RtcB family protein -
N4725_RS19590 (4024066) 4024066..4024518 - 453 WP_106475066.1 GNAT family N-acetyltransferase -
N4725_RS19595 (4024528) 4024528..4024926 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
N4725_RS19600 (4024929) 4024929..4025222 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
N4725_RS19605 (4025274) 4025274..4026329 - 1056 WP_001550655.1 DNA polymerase IV -
N4725_RS19610 (4026400) 4026400..4027185 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
N4725_RS19615 (4027157) 4027157..4028869 + 1713 Protein_3841 flagellar biosynthesis protein FlhA -
N4725_RS19620 (4028974) 4028974..4029252 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
N4725_RS19625 (4029245) 4029245..4029601 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T278743 WP_001263491.1 NZ_CP123240:c4024926-4024528 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT278743 WP_000554755.1 NZ_CP123240:c4025222-4024929 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References