Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1258176..1258903 | Replicon | chromosome |
| Accession | NZ_CP123240 | ||
| Organism | Escherichia coli strain YZLc1-3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | N4725_RS06150 | Protein ID | WP_000547555.1 |
| Coordinates | 1258176..1258487 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4725_RS06155 | Protein ID | WP_000126294.1 |
| Coordinates | 1258484..1258903 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4725_RS06125 (1254111) | 1254111..1255820 | + | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
| N4725_RS06130 (1255830) | 1255830..1256372 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| N4725_RS06135 (1256372) | 1256372..1257139 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| N4725_RS06140 (1257136) | 1257136..1257546 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| N4725_RS06145 (1257539) | 1257539..1258009 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| N4725_RS06150 (1258176) | 1258176..1258487 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N4725_RS06155 (1258484) | 1258484..1258903 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N4725_RS06160 (1258982) | 1258982..1260406 | - | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
| N4725_RS06165 (1260415) | 1260415..1261872 | - | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| N4725_RS06170 (1262132) | 1262132..1263142 | + | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
| N4725_RS06175 (1263291) | 1263291..1263818 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T278731 WP_000547555.1 NZ_CP123240:1258176-1258487 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT278731 WP_000126294.1 NZ_CP123240:1258484-1258903 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|